(data stored in ACNUC7421 zone)

EMBL: CP000478.PE547

CP000478.PE547       Location/Qualifiers
FT   CDS_pept        complement(671325..672548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0552"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gsu:GSU0773 multidrug resistance protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16251"
FT                   /db_xref="GOA:A0LFP9"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFP9"
FT                   /protein_id="ABK16251.1"
FT                   /translation="MNPDDPSLKSTVAFVRLLFLCCIVCFFCYVGAYMRVPVVPLFALS
FT                   LGADAFEVGLINSSFLFMAALLSLPLGIVSDRLGRKSLILGGILLTSLSSFLLCLCRNP
FT                   MQMVLVYLLFGVGLAAFAPTLMSYVADFAPATHLGRSYGYYTMALYGGMSLGPALGGAL
FT                   AEVTGYPAVFAISGGFGFLMFCLVLVLLPRTPRTAAHSSRKLDSMAVAGTFLTNRPLLG
FT                   CWMGTLGGCFGLGMFVTFVPLHAAEQGISVASIGLIFASQSLFNAVARIPFGHFTDRVK
FT                   DRGAVVVFGLIGFSIAVSGIAFSTGIFHFIGFSIALGITMSLTFTALGALISEVVPHDS
FT                   RGLAMGGYSTCIYLGMMLSAVSMGALARDLGFKSAFLVTAGVIALTGVVFRAFVTRIPP
FT                   SPSAGNLL"
     atgaatccgg acgatccatc gttgaagtcc accgtggcct ttgtccgtct tcttttcctg        60
     tgctgtatcg tatgcttttt ttgttatgtc ggcgcgtaca tgcgggttcc ggtggttcca       120
     ctgtttgcgc tgtccctggg cgcggatgcg ttcgaagtcg gattgatcaa ttcttccttt       180
     cttttcatgg ccgcgcttct ttcacttcca ctgggaatag tgtcggatcg gctgggcagg       240
     aagtccctca ttctgggagg aattctactg acgtcactga gctcctttct cctctgcctg       300
     tgtcgaaatc ccatgcagat ggtcctcgtt tacctcctgt tcggggtcgg cttggccgct       360
     tttgccccga cgttgatgtc ctacgttgcc gatttcgctc ccgcgacgca cctggggcgc       420
     tcctacggtt actacaccat ggcactgtac ggaggcatga gcctgggacc cgcattgggc       480
     ggagccctcg cggaggtcac gggttacccg gccgtgttcg cgatttcggg aggtttcgga       540
     ttcctgatgt tctgccttgt cctggtgttg ctgccccgga caccccgcac cgccgcccac       600
     tcttcccgaa agctcgacag catggccgtc gcggggacgt tcctcaccaa tcgtcctctc       660
     ctcggctgct ggatggggac cctcgggggg tgtttcggcc tggggatgtt cgtgactttt       720
     gttcccctgc atgccgcgga acagggcata tcggtggcga gcatcggcct catttttgcc       780
     tcgcagtcgc ttttcaacgc ggttgcgcgg atcccgttcg gccactttac cgatcgagtc       840
     aaggaccgcg gtgccgttgt ggtcttcggg ctgatcggct tctcgatcgc cgtttcgggg       900
     atcgcattct cgaccggcat ttttcacttc atcggctttt cgatcgcact cgggatcacc       960
     atgagtctga cgttcaccgc gctgggagcg ctcatatccg aggtggtccc gcatgatagc      1020
     cgcgggctcg ccatgggagg ctacagcacc tgcatctacc ttggaatgat gctgagcgcc      1080
     gtgagcatgg gcgcactggc ccgcgacctg ggattcaaga gcgcgttttt ggtcacggcc      1140
     ggggtcatcg cattgacggg cgtcgtcttc cgggcctttg tgaccaggat tccgccttcc      1200
     ccatcggccg ggaatctgtt atag                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page