(data stored in ACNUC7421 zone)

EMBL: CP000478.PE548

CP000478.PE548       Location/Qualifiers
FT   CDS_pept        complement(673208..673657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0553"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16252"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ0"
FT                   /protein_id="ABK16252.1"
FT                   /translation="MRSVHAGCNAAKILIIVLAALITASCGMATKEEKQHEQFVAAIDG
FT                   YNAAFRWQDYKTASGFVDPANQEAFWKEADAFLKEVRIMDYEIRNVSFEANGLRGTVFI
FT                   NCRFYLTREPSLQSKMIRQTWQFLEKPKTWQVTNSGYQAILAQTQ"
     atgagatcgg tccatgccgg atgcaatgcc gccaagattt tgattattgt tctggccgcc        60
     ctcattaccg cttcatgcgg catggcgacc aaagaagaga aacagcacga acaattcgtc       120
     gccgccatcg acgggtacaa tgccgctttc cggtggcagg actacaagac cgcatcgggc       180
     ttcgtggatc ccgcgaacca ggaagcgttc tggaaagaag cggatgcgtt tctcaaggaa       240
     gtgaggataa tggactatga aatcaggaac gtatcattcg aagccaacgg tcttcgaggc       300
     accgtgttca tcaactgccg tttctacctg accagggaac ccagccttca gagcaagatg       360
     attcgccaga cgtggcagtt cctggaaaaa ccgaagacat ggcaagtgac gaacagtggg       420
     tatcaggcga ttctggcaca aacccaatag                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page