(data stored in ACNUC7421 zone)

EMBL: CP000478.PE549

CP000478.PE549       Location/Qualifiers
FT   CDS_pept        complement(673761..674336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16253"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ1"
FT                   /protein_id="ABK16253.1"
FT                   /translation="MATASARNGTEERRTPFERLSRRNARPVFFTSSTHAAGVLFMTPP
FT                   APLSRKDRRGPFFSVGSVSAPSGEGAILPPLPAATARFPGCAIPRGRVAPRGVNLRAAH
FT                   ADYEKKEPTGKPAGEKTFVKRPSDARECFESSGFRILRGTNAGNHVQHAPWEDATTVGS
FT                   GSGRSSSLPQKPGESAAAAGAGNDLQLS"
     atggcgactg catcggccag aaacgggacg gaagagcggc gaacaccatt cgaacgcctt        60
     tccaggcgga acgctcgccc ggtttttttc acttcctcga cccacgcagc aggagttcta       120
     ttcatgaccc caccggcgcc gctttcacga aaggaccgcc gcggcccttt cttttccgtc       180
     ggctccgtgt ccgctccctc cggggaggga gcgatccttc ccccgcttcc ggcggcgacg       240
     gcgcggtttc ccggatgcgc catcccgcgc ggtcgagtcg ctccccgcgg ggtaaacctc       300
     cgcgccgcac atgccgatta tgagaaaaag gaacccaccg gaaagccggc gggcgaaaag       360
     actttcgtga agcgcccgtc ggatgctcgt gagtgtttcg aatcctccgg gttccgcata       420
     ttgagaggta ctaatgcagg caaccacgtt cagcacgcgc cgtgggagga cgcgaccacc       480
     gtcgggtccg ggtccggacg gtcttcttct ctcccgcaga agccgggcga gtccgcggcg       540
     gcggccgggg ccggcaatga tctacaattg tcttga                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page