(data stored in ACNUC7421 zone)

EMBL: CP000478.PE551

CP000478.PE551       Location/Qualifiers
FT   CDS_pept        675489..677153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0556"
FT                   /product="peptidase C14, caspase catalytic subunit p20"
FT                   /note="PFAM: protein of unknown function DUF323; peptidase
FT                   C14, caspase catalytic subunit p20; SMART: peptidase C14,
FT                   caspase precursor p45; KEGG: dps:DP2442 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16255"
FT                   /db_xref="GOA:A0LFQ3"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ3"
FT                   /protein_id="ABK16255.1"
FT                   /translation="MLGLSTKTFLLMMATVLLAASGPVDRVWGADAAPPVENASQAEQR
FT                   TALVIGNGAYASAPLRNAVNDARTMGETLKGLGFDVVEHENLNQKEMKKEIQAFGQRLL
FT                   KGGVGLFYYAGHGMQVNGRNYLIPVGAAIEHEKQVEYEAVDVGAVLTEMDYARNRLNIV
FT                   ILDACRDNPFARSFRSSMQGLASMNAPTGTIVAYATAPGAVANDGPGDHGVYTGELVKA
FT                   MEAPGLRIEDVFKQVRSSVRETTQGKQVPWESSSLEGDFYFKFPTAATPPVPVPDKPVP
FT                   VPQTVTARGEKPARTLKTWKEPITGMEFVWVPGGCFLMGSPQTEKDREADEGPVHEVCV
FT                   DGFWMARTEVTNGQFRKFRADHNSRDYSGVSLNGDNQPVVYVTWNDANDFAQWLKGQNG
FT                   GQYKFRLPTEAEWEYASRAGKESSRYWGDDPNKACTHENVADLTAKRQWKWEESHDCDD
FT                   GYAAIAPVGTFQANDFGIYDMLGNVWEWCEDIYGVDAYTRHDRMNPSFTDRTAGTGRVV
FT                   RGGYWHSQPGGARCADRGSGLPEAMNDDLGFRLVREP"
     atgctgggat tgagcaccaa gactttctta ctgatgatgg cgacggtact gctggcggcg        60
     tccgggcccg tggaccgggt ctggggagcc gacgcggccc cgccggtgga aaatgcttcc       120
     caggcggagc aacgcaccgc gctggtgatc gggaatgggg cttacgcttc cgctcccttg       180
     cgcaatgcag tcaacgacgc gcgcaccatg ggagagaccc tgaagggact cggcttcgat       240
     gtggtcgagc atgagaacct caaccagaag gagatgaaga aggaaatcca ggccttcggc       300
     cagaggctgc tcaagggggg cgtcgggttg ttttattatg ccggacacgg tatgcaggtg       360
     aacggacgca actacctgat tccggtgggg gctgccatcg agcacgagaa acaggtggaa       420
     tacgaggccg tggatgtcgg cgcggttctg acggaaatgg attacgccag aaatcgtttg       480
     aacatcgtca tattggacgc atgccgggac aatccgtttg cgcggagttt ccgttcttcc       540
     atgcagggac tggcttccat gaatgccccc acgggtacga tcgtggccta tgcgacggcc       600
     ccaggggcgg tggcaaacga cgggccggga gaccacggag tttacacggg cgaactggtc       660
     aaggcgatgg aggctcccgg gctgcggatc gaggacgttt tcaagcaggt gcggtccagc       720
     gtgcgggaga caacccaggg gaaacaggtt ccctgggagt cctcctccct ggaaggagat       780
     ttctacttca agtttcccac cgccgcgacc ccacccgttc cggttccgga caagccggtt       840
     ccagtgccgc aaacggtcac cgcgagaggc gagaagcctg ccaggacact caagacctgg       900
     aaggaaccga tcaccgggat ggagttcgta tgggtgcccg gaggctgctt tctcatgggc       960
     agcccccaga ccgagaagga ccgtgaagcc gatgaagggc cggtgcacga ggtatgcgtg      1020
     gacggcttct ggatggcgcg caccgaagtg accaacggcc agttcagaaa attccgtgcc      1080
     gatcacaaca gcagggacta ttccggggta tcgctcaatg gagacaatca gcccgtggtt      1140
     tatgtcacgt ggaacgatgc caatgatttt gcccagtggc tgaagggtca aaacggcggc      1200
     cagtacaaat tccggcttcc caccgaggcc gaatgggaat acgcatcccg ggccggaaag      1260
     gagtcctcca ggtactgggg ggatgatccg aacaaggcct gcactcatga gaacgtggcc      1320
     gatttgacgg cgaaacggca gtggaaatgg gaggaatcac acgactgcga cgacggttac      1380
     gcggcgatag cccctgtggg tactttccag gcgaacgatt tcggcattta cgatatgctc      1440
     ggcaacgtct gggagtggtg cgaggacata tacggcgtcg atgcctatac caggcacgat      1500
     cggatgaatc cgtcgtttac ggaccggact gccggaaccg gtcgggtcgt ccggggggga      1560
     tactggcatt cgcagccggg cggcgcgagg tgtgccgacc ggggcagcgg cttgcccgag      1620
     gcaatgaacg acgatctcgg gtttcgattg gtgagggaac cctag                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page