(data stored in ACNUC7421 zone)

EMBL: CP000478.PE553

CP000478.PE553       Location/Qualifiers
FT   CDS_pept        677914..679911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0558"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   CHASE2 domain protein; KEGG: sat:SYN_01481 adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16257"
FT                   /db_xref="GOA:A0LFQ5"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ5"
FT                   /protein_id="ABK16257.1"
FT                   /translation="MSTSRRGNVRATTALVVASFAVVALCFRLLPWVFEPWNSQLVDKL
FT                   FVLRSSVSWLRPVYDPTVVHVDITNSTLHRLDDFYLKRVQFARVVRNLAAMRTAAQAYD
FT                   FIFGTKPDDRDDPALIAAAREAGNAYFGLALALSPQRAARETKVDEEALRTLASTKWVL
FT                   NVEGDVTGFHRGSAPLATFPALAAVSKGLGHISIKIDADGIVRRVPLLVRYEDGFYPSL
FT                   PFRVICDYLGVPPQHIRVVPAEAVVLQQARRPGAPPRDIRIPIDRAGSMIVSFIGPWET
FT                   MKHYNFADVYIASDSRDELEVWRDELEGKIVVVSDVSTGSTDLRPVPTDTEYPLSGMHA
FT                   NAIHTILTEDFFRESTAAEAFLVELSLMACLIVLARSFSSVAFTASAAGMVALCAGGAL
FT                   VSFFSLHAIPQVVRPVLSIGLAVFLVLAYRYINEEKQKEVYRRSFEAYFPPAVVKKIMA
FT                   HPESMAMSAQRKELTVLFSDIASFTTYSSALAPDRIRGFLNEYFDAMVEIVFNHGGTVD
FT                   KYIGDGLMVFFGDPEPQEDHATRCVQAAIDMQRRVRELQNAWRNAGGFPLAVRIGINTG
FT                   EVVVGNMGSRRQFSYTVLGSPVNLAQRLESNAPVGGILISERTRQLIGDGFQTKALGEI
FT                   KVKGIAEPVAVHEVTVSQGEVQDSNSAGNV"
     ttgagcacaa gtagacgggg gaacgttcgg gccacgaccg ccctggtcgt ggcctccttt        60
     gccgtcgtgg cgctgtgctt cagactcctg ccatgggtgt tcgaaccctg gaattctcaa       120
     ctcgtcgata aactcttcgt gctgcgttca tccgtttcgt ggcttcgacc cgtctacgac       180
     ccgaccgtcg tgcacgtgga catcaccaat tccacgcttc acaggctcga tgacttctat       240
     ctcaaacggg ttcaattcgc gcgcgtggtg cgcaatctcg ccgcgatgcg cacggcggcc       300
     caggcgtatg attttatttt cgggacaaaa cctgatgacc gggacgatcc ggcactgatc       360
     gcagccgcgc gtgaggcggg caatgcctat ttcggccttg ccctggcgct ttccccgcaa       420
     agagccgcgc gcgagaccaa agtggacgag gaagcgctcc gcaccctggc ctcaacgaag       480
     tgggtgttga acgtggaggg cgacgtcacg ggcttccatc gcggctcggc cccgctggcg       540
     actttccccg ctttggccgc cgtgtcgaaa ggcttgggac acatcagcat caagatcgac       600
     gcggatggca tcgtacgcag ggtgcccctg ctggttcgct acgaagacgg tttctatccc       660
     agcctgcctt ttcgcgtcat ttgcgattat ctcggggtgc ctccgcaaca catccgggtt       720
     gtcccggcgg aggcggtcgt gctgcagcag gcgcgcagac cgggggctcc cccgcgcgat       780
     atccgcatcc ccatcgaccg ggccgggagc atgatcgttt cctttatcgg cccgtgggag       840
     acgatgaagc attacaattt cgccgacgtg tatattgctt ccgacagccg agatgaattg       900
     gaggtatgga gggacgaact ggaagggaag atcgtcgtgg tctccgatgt ctccaccgga       960
     tcgaccgacc tcaggccggt gccgaccgac acggagtatc cgttgagcgg aatgcacgcg      1020
     aacgcgatcc acactatcct cacggaagat ttttttcgcg agagcactgc ggcggaagcg      1080
     ttcctggtcg agctctccct gatggcgtgc ctgattgtcc tggcacgaag tttttcttcg      1140
     gtcgcgttca ccgcgagtgc ggcgggaatg gtggcattgt gcgcgggcgg agcgcttgtc      1200
     agcttctttt cgctgcacgc gatcccgcag gtcgtcaggc cggtcctttc catcggcctc      1260
     gccgtcttcc tcgtgcttgc ctaccggtac atcaacgaag aaaaacagaa ggaagtgtac      1320
     agaagatcct tcgaagccta tttcccgccg gctgtggtga aaaagatcat ggcccatccc      1380
     gaatcgatgg ccatgagcgc gcagcgcaag gagctgaccg tgctgttcag cgacatcgcg      1440
     agtttcacga cgtactcctc ggccctcgca cccgaccgga ttcgcggttt tctgaacgag      1500
     tatttcgacg ccatggtcga gatcgtgttc aaccacggcg gcacggtgga caagtacatc      1560
     ggggatgggc tgatggtgtt cttcggcgac cccgaacccc aggaggatca cgcgacgcga      1620
     tgcgttcagg ccgccatcga catgcagcgt cgcgtgcgag agctccaaaa tgcctggcgg      1680
     aatgcgggag ggtttcctct tgccgtgcgt atcggaatca acacgggtga ggtggtggtc      1740
     ggcaacatgg gatccaggag gcagttttcg tacacggtcc tcggatcccc ggtgaatctc      1800
     gcccagcgcc tcgaatccaa cgctcccgtg gggggcattc tcatttccga acggaccagg      1860
     cagttgatcg gggacggatt ccagacgaag gcattggggg aaattaaggt caagggaatc      1920
     gcggagcccg ttgccgtgca cgaggtaacg gtgtcacagg gtgaagtgca ggattcgaac      1980
     agtgccggga atgtgtga                                                    1998
//

If you have problems or comments...

PBIL Back to PBIL home page