(data stored in ACNUC7421 zone)

EMBL: CP000478.PE554

CP000478.PE554       Location/Qualifiers
FT   CDS_pept        complement(679995..681566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0559"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: Forkhead-associated protein; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; GAF domain protein; KEGG:
FT                   mxa:MXAN_3956 putative adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16258"
FT                   /db_xref="GOA:A0LFQ6"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ6"
FT                   /protein_id="ABK16258.1"
FT                   /translation="MARLIIHDTEGVQEIDLVDRNSIGRLSRNRIRIADDLVSKEHCLI
FT                   YLDPRGGYGIKDLGSQNGTFVNGHRIVRETPLSDRDVVTIGRTSCIFLAGDLPHGTSDG
FT                   MEATIQFMDADRSWSQIAQDRFLPEEEIWDEKVLRADYEKLRIAHELQREIGLELNLDR
FT                   IFNRILDRTFQLLNCDRAVILMVGENGGMEVRASKTRHSGEDLVVSSTLVNFVREHKVG
FT                   LICGDALADERFSCAESICNRNIRSSMAVPIVYEQELLGVMIIDSSASVRAYAEKDLLL
FT                   FNNIAHQTSQFTMMAKMAKRIEEEALTRERFQRLMSPDLAEMVVSGSIKVEKGGQNRVA
FT                   TILFADIRGFTSMCENMRAAEVLIMLNEFFELMVDVGFRHEGTVANFIGDMIMLVWGAP
FT                   VFHPDDPVRAVQAAVEMQEVLAEYNRGRREKGLPEIGVGIGINTGDLMAGYLGSTRTMT
FT                   YSVIGDPVNVASRLCALARQNQILISEHSRLSVDNHFETAEISTVKVKGRKAPIRIYEV
FT                   VGRKRN"
     atggcgagac tgatcatcca cgacacggaa ggcgtgcagg aaatcgatct ggtggatcgc        60
     aattccatcg gaaggctttc tcgaaatcgc atcaggattg ccgacgatct ggtgtccaag       120
     gaacactgcc tgatctatct cgatcccagg ggcgggtacg gcatcaagga tttgggcagt       180
     cagaacggca ctttcgtcaa cggacatcgc atcgttcgcg aaacacccct gagcgacagg       240
     gatgtggtca ccatcggcag gacaagctgt attttcctgg ccggggacct cccgcacggg       300
     accagcgacg gcatggaagc gacgatccag ttcatggacg ccgaccgttc gtggtcacag       360
     attgcccagg accgttttct gcccgaagaa gaaatctggg atgagaaggt tctgcgcgcc       420
     gattatgaga agctgcgcat cgctcacgag ctccaacgcg aaatcgggct cgagctcaat       480
     ctcgaccgga tctttaatcg catcctggac cgtactttcc agcttctcaa ctgtgatcgt       540
     gccgtcattt tgatggtggg cgaaaacggc gggatggaag tgcgggcatc caagacccgt       600
     cattccggcg aggacctggt ggtgtcttcg accctggtca atttcgttcg cgaacacaag       660
     gtgggcctga tttgcgggga cgccctggcg gacgagcgtt tcagctgcgc cgaatccata       720
     tgcaatcgca atattcgttc ctccatggcc gtgcccatcg tttacgaaca ggagctcctg       780
     ggagtcatga tcatcgattc ctcggcctcg gtcagagcat acgcggaaaa ggatctgctg       840
     ctcttcaaca acatcgccca ccagacttct cagttcacga tgatggcgaa aatggccaag       900
     cgaatcgagg aggaagctct gacgcgagag cgttttcagc ggctcatgtc tcccgacctg       960
     gcggaaatgg tggtctcggg ctcgatcaag gtcgaaaagg gagggcaaaa ccgcgttgcg      1020
     accatcctct ttgccgacat ccggggtttc acgtccatgt gtgagaacat gcgggcggcc      1080
     gaagtgctca tcatgctcaa cgagttcttc gaactgatgg tcgatgtggg cttccgccac      1140
     gaaggcaccg tggcgaactt cataggggac atgatcatgc tggtttgggg cgctcccgtt      1200
     tttcatccgg acgacccggt tcgagccgtc caggcggcgg tggagatgca ggaggttctt      1260
     gccgaataca acagggggcg tagagaaaaa gggctgccgg aaatcggagt cggcatcggc      1320
     atcaacacgg gggacttaat ggcggggtac ctggggtcca cgcgaaccat gacctattcg      1380
     gtgatcgggg atcccgtcaa cgtggcatcc aggctctgcg ccctggccag gcagaaccaa      1440
     atcctcattt cggaacactc tcgtttgagt gtcgacaatc atttcgagac agccgagatc      1500
     tccactgtca aggttaaggg cagaaaggct cccatcagga tttacgaagt ggtcggaaga      1560
     aagcggaatt ga                                                          1572
//

If you have problems or comments...

PBIL Back to PBIL home page