(data stored in ACNUC7421 zone)

EMBL: CP000478.PE555

CP000478.PE555       Location/Qualifiers
FT   CDS_pept        complement(681773..682558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0560"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   mxa:MXAN_3502 adventurous gliding motility protein AgmI"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16259"
FT                   /db_xref="GOA:A0LFQ7"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFQ7"
FT                   /protein_id="ABK16259.1"
FT                   /translation="MGTPPKISARNLEQQQAARNQKRFVFSLGPRQIVLCAAGLLLAMC
FT                   WMFIFGILVGRGLPMISSEDVSVRAEFMRFLGLDRPPPSTVEKAAETWQAPEKMLESLK
FT                   YYEELTRKEVFTQAKTAVPPGAPSTSPAAKDAAADTRNKPTKSLPVPLSTPDKPESSDS
FT                   EKTGSGAGGQEPVAANNASEHFTLLVASLKDADNAQKLVEQLRAKGYAPRLHTLDLNGG
FT                   GRWNRVLVGSFRNRESALKFAADFNKKERMEGLVIRESN"
     ttgggcactc ctcccaaaat atccgctcgt aatctcgagc agcagcaagc tgccaggaat        60
     cagaagcggt ttgtcttttc attgggcccg agacagatcg tcctctgcgc ggcgggtctc       120
     ttgctcgcca tgtgctggat gttcatattc ggaatcctgg tggggcgggg gctgccgatg       180
     atatcctcgg aagacgtttc cgtccgggcg gaattcatgc gtttccttgg cctggaccgc       240
     ccgcctccct caaccgtcga gaaagccgcg gaaacatggc aggcgccgga gaagatgttg       300
     gagtcgctca aatactacga ggaactgacc cgcaaggagg tcttcaccca ggccaaaacc       360
     gccgttccac cgggcgcccc gtcgacgtcg cctgcggcaa aagacgccgc ggcagatacc       420
     cggaacaaac cgaccaagtc cctgccggtc cccttgtcga cgccggacaa acctgagtcg       480
     tcggactcgg aaaagacggg ttcgggggcc ggcggccagg agccggtggc ggcaaacaac       540
     gcttcggaac acttcactct gctggtggcg tcgctaaaag acgccgacaa cgctcagaag       600
     ctcgtggaac agctgcgcgc caaagggtac gcaccacggc tgcacaccct cgacctcaac       660
     ggcggtggac gatggaaccg ggtcctggtc ggttcttttc gcaacaggga atccgcgttg       720
     aaattcgcag ccgacttcaa taagaaggaa cgcatggaag gactggtcat tcgcgagtcc       780
     aattga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page