(data stored in ACNUC7421 zone)

EMBL: CP000478.PE558

CP000478.PE558       Location/Qualifiers
FT   CDS_pept        686122..686325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dps:DP2542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16262"
FT                   /db_xref="GOA:A0LFR0"
FT                   /db_xref="InterPro:IPR019201"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR0"
FT                   /protein_id="ABK16262.1"
FT                   /translation="MHAGYLLTVLGLICFLEGLPYLASPDYLKKWLIEVVIPAPSRYLR
FT                   LFGGVLMVLGLLFVYWGRRHGG"
     atgcacgcgg gctatctgct taccgtactg ggactgatct gctttctgga agggttgccg        60
     tacctggctt cccccgatta tctgaagaaa tggctgatcg aggtcgtcat ccccgcgcca       120
     agccgttacc tgcgcctttt cggcggcgtg ctcatggtcc ttggcctgct tttcgtgtac       180
     tggggccgtc ggcatggcgg atga                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page