(data stored in ACNUC7421 zone)

EMBL: CP000478.PE559

CP000478.PE559       Location/Qualifiers
FT   CDS_pept        686315..687388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0564"
FT                   /product="Queuosine biosynthesis protein"
FT                   /note="PFAM: Queuosine biosynthesis protein; KEGG:
FT                   hch:HCH_04470 S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16263"
FT                   /db_xref="GOA:A0LFR1"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR1"
FT                   /protein_id="ABK16263.1"
FT                   /translation="MADERISYRLREYDYDLPPSLIAQSPLSRREESRLLVLDRGRGAM
FT                   DHVRFRDLPDHLHAEDLLVVNDTRVVPARLIGFKDSGGRIELLVTEPYKSEAEGRRDGY
FT                   WCLAAAAKRTRPGCLISLPDGTVAEVLEAGDGGRIRVRFPDDRPLMTILSEIGAVPLPP
FT                   YINRSGTGDFPGDAEAYQTVYARNPGAVAAPTAGLHFSSALLEAVARAGVEVVRITLHV
FT                   GYGTFAPIRVDDIRDHEMHPEYVRVDEDSTERIRSAIDRKRRIVAVGTTVVRSLEWIAH
FT                   RRGEIMPAAGACAHYIYPGYRFKVVDAMITNFHLPRSSLLLLVSAFAGRRRILEAYREA
FT                   IRREYRFFSYGDAMLIL"
     atggcggatg agcgcatttc ctaccgactc cgggaatacg actacgatct ccctccctcc        60
     ctgatcgcac aatccccctt atcccgaagg gaggaatccc gtcttctcgt gctggaccga       120
     ggccgcggcg cgatggatca cgttcgcttc cgggatttgc cggaccatct gcacgccgaa       180
     gacctgctgg tggtcaacga cacccgggtg gtgccggcgc gtttgatcgg cttcaaggat       240
     tcgggcggca ggatcgaatt gctggtgacg gaaccctaca aaagcgaagc cgaagggcgg       300
     cgggacggtt actggtgtct tgccgcggcc gcaaaacgca cccggcccgg atgcctgatc       360
     tcgcttcccg acggtacggt cgctgaagtt ctcgaggcag gcgacggcgg gcggattcga       420
     gtccggttcc ctgacgaccg cccgctgatg acgatcctct cggagattgg agcggtgccg       480
     cttccgccat acatcaaccg gagcggaacc ggtgactttc ccggagacgc cgaagcctac       540
     cagacggtgt atgcgcgaaa tcccggagcc gtggccgcgc cgaccgccgg ccttcacttc       600
     agctcggcac tgctggaggc cgtcgcacgg gcgggggtcg aagtcgtccg gattaccctt       660
     catgtgggat acggcacctt cgcccccatc agggtcgacg atatccggga ccacgagatg       720
     catccggaat acgtgcgggt ggacgaggat tcgacggagc ggatcaggtc cgcgatcgat       780
     cggaaaagac gtatcgtcgc ggtgggaacc acggtcgtga ggagtttgga gtggatcgcc       840
     caccggcgcg gcgaaatcat gccggccgcg ggggcctgcg cgcactacat ctacccgggc       900
     taccggttca aagtcgtaga tgcgatgatc accaatttcc accttcccag gtcctccctt       960
     cttctgctcg tttcggcgtt tgccgggcgc cgccgaatcc tggaagcata ccgggaagcg      1020
     atccgccgtg agtaccggtt tttcagttac ggcgatgcga tgctgattct gtag            1074
//

If you have problems or comments...

PBIL Back to PBIL home page