(data stored in ACNUC7421 zone)

EMBL: CP000478.PE566

CP000478.PE566       Location/Qualifiers
FT   CDS_pept        695908..696186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16270"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFR8"
FT                   /protein_id="ABK16270.1"
FT                   /translation="MGPPRSRTPGGRAIAVKRSKAIPGDSERQGIMARFLPLEAAAGGQ
FT                   ARFPADNPAVCAAGLKAPDFPEPSPSPGRPSSAVHGEPESDRIRECE"
     atgggtccgc cccgctctcg cacgccgggt gggagagcga ttgcggtgaa gcgttcaaag        60
     gcaatccccg gcgattcgga acgtcagggc atcatggcac ggttcttgcc ccttgaagca       120
     gcggccggtg ggcaggcccg gtttccggcc gacaaccccg ccgtttgcgc ggcgggcctg       180
     aaggcaccgg atttccccga gccttcgccg tcgccgggaa ggccgtcgtc cgccgttcac       240
     ggtgaacctg aaagcgacag gatacgcgaa tgcgaatag                              279
//

If you have problems or comments...

PBIL Back to PBIL home page