(data stored in ACNUC7421 zone)

EMBL: CP000478.PE568

CP000478.PE568       Location/Qualifiers
FT   CDS_pept        697884..698222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0573"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   ade:Adeh_4248 nitrogen regulatory protein P-II (GlnB,
FT                   GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16272"
FT                   /db_xref="GOA:A0LFS0"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS0"
FT                   /protein_id="ABK16272.1"
FT                   /translation="MKKIEAIVKPFKLDDVKEKLTALGIKGMTVTEVRGFGRQKGHTEI
FT                   YRGAEYVVDFLPKIKIEVAVADVQVVEVVQAIRSAANTGKIGDGKIFVIPLEECIRIRT
FT                   GETGEEAL"
     atgaaaaaaa tcgaagccat tgtcaagccg ttcaaattgg atgacgtcaa ggaaaaactc        60
     accgcgctcg gcatcaaggg gatgaccgtg acggaagtcc gcggattcgg gcgccagaag       120
     ggacacaccg agatctaccg cggggccgaa tatgtggtcg attttctgcc caagatcaag       180
     atcgaagtgg ccgtggcgga cgtccaggtg gtggaagtgg tgcaggccat ccggagcgcg       240
     gccaatacgg gcaagatcgg agacggcaag atattcgtga tccccctcga agaatgcatt       300
     cgcatcagaa cgggtgaaac cggcgaagaa gcgctgtag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page