(data stored in ACNUC7421 zone)

EMBL: CP000478.PE569

CP000478.PE569       Location/Qualifiers
FT   CDS_pept        698236..700830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0574"
FT                   /product="UTP-GlnB uridylyltransferase, GlnD"
FT                   /EC_number="2.7.7.59"
FT                   /note="KEGG: gsu:GSU1820 protein-P-II uridylyltransferase,
FT                   putative; TIGRFAM: protein-P-II uridylyltransferase; PFAM:
FT                   amino acid-binding ACT domain protein; metal-dependent
FT                   phosphohydrolase, HD sub domain; GlnD
FT                   PII-uridylyltransferase; SMART: metal-dependent
FT                   phosphohydrolase, HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16273"
FT                   /db_xref="GOA:A0LFS1"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS1"
FT                   /protein_id="ABK16273.1"
FT                   /translation="MHLRPQLSRKLKDLRETFQQMCREDVPGVLAARTYAHQFHESLRK
FT                   AFPETVVPEDGWGLLAVGGFGRGELGFASDIDLLLLYRNRLVKSHEALFKELVYCLWDS
FT                   GFEVGHATASLSSMKRMAQDDFTVLTNILEARLIAGDPKLFSEWRESFFNGFGRQSRKK
FT                   FLQNLVGYREERQQQYGGSSYLQEPHVKEGVGAMRDVHILRWAGHVFLRDPSFAAMVRK
FT                   ELMTNQEKLWLEQAYDFLWRVRLQLHRLTGRRQDQLLFMEQEQIAERFGCMAGQQGSAV
FT                   EVFMRLYYRHTSRIRRTASFFLERVGETQKSFPGLRPRRRILPGPFLLEGKHLNFMEPE
FT                   WIKKDPRLLMRFFWQAALSDAHFHHQAGQIIRENLAVFTDEARRDPEVVKQFFDILLDS
FT                   EHAFSVVNVMLETGFLEVFIPEFAAVRYRVQNDVYHLYTVDEHLLRTVWQMHQMERGDD
FT                   EVAGELNPSDIFVHVKSRRVLYLAALVHDIGKGDGRNHAVRGGAMAGPIAERLGLDTHE
FT                   TGLLRFLVEHHLILAETALKRDLMDEKPIAQCAIQIKDRERLQMLYLLTIADSRATGPG
FT                   AWSTWKASLVRELFVKVDRVLARGDLQGQDLEQRSGEVQENVLDLVSDPAERERVRHWL
FT                   ERVSYRYLLSQAPTAIVEHHRMERALGNKPLVLASSPAEGEMWQLTVVTADRPGLFALI
FT                   TGVLWARGLNILSADIFTWESGVALDVLIVERLPDPLHPRELWERVEADLGRALEHRGY
FT                   LDELLSNKRKPSILQQKNLPRKDDIVLVDEEASDFYTIIEVYTWDRPGVLHCITDTLYH
FT                   LDVSIQLAKISTPGAQVADVFYVTDLSGNKLMDYEMHEKIRVSLLDSLTRVG"
     atgcacttgc gtccccagct ctcccgaaag ctcaaagacc tccgggaaac cttccagcag        60
     atgtgccggg aggacgtccc cggcgtgctt gcggcgcgca cctacgcgca ccagtttcat       120
     gaaagcctca ggaaggcttt tcccgaaacg gtcgtgcccg aggacggctg ggggctgctt       180
     gcggtcggcg gcttcggacg cggcgagctg ggattcgcct cggatatcga tctcctgctg       240
     ctgtaccgaa accggctggt caaatcccac gaggcccttt tcaaggaact ggtctactgc       300
     ctgtgggaca gcgggttcga agtcggccac gcaacggctt ccctgtcctc gatgaaacgg       360
     atggcccagg atgacttcac cgtgctgacc aacatcctcg aagccaggct catcgcgggc       420
     gatcccaagc tgttctcgga atggcgcgaa tcctttttca acggcttcgg gaggcagagc       480
     aggaaaaaat tcctgcagaa cctcgtcggt taccgcgagg aacgccaaca gcagtacggc       540
     ggaagctcct acctgcagga accgcacgtg aaggaggggg tcggcgccat gcgggacgtc       600
     cacatcctgc gctgggccgg ccacgtgttc ctgcgggatc cttcctttgc ggccatggtt       660
     cgcaaggagc tgatgaccaa ccaggagaag ctctggctgg agcaggcgta cgatttcctc       720
     tggcgcgtgc gcctgcagtt gcaccggctg accgggcgca ggcaggatca gctgctgttc       780
     atggaacagg aacagatcgc cgagcggttc gggtgcatgg ccggtcagca gggttccgcg       840
     gtggaagtgt tcatgcggtt gtattaccgg cacacgtcgc gcatccgccg caccgcgtcg       900
     ttcttcctgg aacgagtggg agaaacgcag aaaagctttc cgggtctgcg cccgcggcgc       960
     aggattcttc ccggaccgtt cctgctcgaa ggcaagcacc tcaacttcat ggaaccggaa      1020
     tggatcaaaa aggatccgcg cctgctgatg cgcttcttct ggcaggccgc cctctccgat      1080
     gcgcacttcc accaccaggc cgggcagatc atccgggaga acctcgcggt cttcaccgat      1140
     gaagccagaa gagatcccga ggtggtgaag cagtttttcg atatcctgct ggattccgag      1200
     cacgcgtttt cggtcgtgaa cgtgatgctc gaaaccgggt tcctcgaggt cttcattccc      1260
     gaattcgccg cggtgcgcta ccgggtgcaa aatgacgtgt atcacctcta cacggtcgac      1320
     gagcacctgc tgcggacggt ctggcagatg caccagatgg aacggggcga cgacgaggtc      1380
     gcgggcgaac tgaacccgag tgacattttc gtacacgtga agtcgcggcg ggtcctctac      1440
     ctcgcggcgc tcgtgcacga catcggcaag ggcgacggca ggaatcatgc ggtgcgcggc      1500
     ggcgccatgg ccgggcccat tgcggaaagg ctcggcttgg acacgcacga aaccggcctg      1560
     ctccggtttc ttgtggagca tcacctgatc ctggccgaaa ccgcgctcaa gcgcgacctg      1620
     atggacgaga agcccatcgc tcaatgcgcc atccagatca aggaccggga gcgcctccag      1680
     atgctctacc tgctcaccat cgccgactcc cgggccaccg gccccggcgc ctggagcacg      1740
     tggaaggcct cactggtccg ggagttgttc gtcaaggtcg accgggtcct tgcgcggggc      1800
     gatctccagg gacaggacct ggagcagcgg tccggggagg tccaggaaaa cgtgctcgac      1860
     ctggtgagcg atccggccga gcgcgaaagg gttcggcact ggctggaacg ggtttcgtac      1920
     cgttatctcc tgtcccaggc cccgaccgcg atcgtcgagc atcaccggat ggagcgggcg      1980
     ctggggaaca aacccctggt gttggcctcg agcccggccg agggcgaaat gtggcagttg      2040
     acggtcgtca ccgccgatcg tcccggcctg ttcgcgctca tcacgggagt cctgtgggcg      2100
     cgcgggctca atatcctctc ggccgacatc ttcacctggg agtccggcgt ggcgctggat      2160
     gtgctgatcg tggaacggct tcccgacccg ctgcatccgc gggaactgtg ggaaagggtg      2220
     gaggccgatc tcggcagggc gctcgagcac cgcgggtacc tggacgagct cctgtcgaac      2280
     aaacgaaaac catcaatttt gcagcagaag aatcttccgc gcaaggacga catcgtgctc      2340
     gtcgacgaag aggcgtccga tttctacacc atcatcgaag tctacacctg ggaccgtcct      2400
     ggggtgctcc attgcatcac cgacaccctg taccacctgg atgtctccat ccagctcgcc      2460
     aaaatctcca ctcccggcgc tcaagttgca gatgttttct acgtgacgga tctgagcggc      2520
     aacaagctga tggactatga gatgcacgag aagattcgcg taagcctcct ggacagtctc      2580
     acgcgggtgg gctga                                                       2595
//

If you have problems or comments...

PBIL Back to PBIL home page