(data stored in ACNUC7421 zone)

EMBL: CP000478.PE571

CP000478.PE571       Location/Qualifiers
FT   CDS_pept        701361..702773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0576"
FT                   /product="L-glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /note="KEGG: gsu:GSU1835 glutamine synthetase, type I;
FT                   TIGRFAM: glutamine synthetase, type I; PFAM: glutamine
FT                   synthetase, catalytic region; glutamine synthetase,
FT                   beta-Grasp"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16275"
FT                   /db_xref="GOA:A0LFS3"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS3"
FT                   /protein_id="ABK16275.1"
FT                   /translation="MTPKEVLAYAKQNGAKMVDFKFMDFVGTWQHFTNPIDELGESDFE
FT                   NGYGFDGSSIRGWQPIHASDMLIIPDPTTAKMDPFMAVPTLTMICDVVDPVTKERYTRD
FT                   PRYIAHKAEEYLKFTGIGDAAWFGPEAEFFIFDDIRFDDGCQFGYYHIDSVEGIWNSGR
FT                   VENPNLGYKPRHKEGYFPVPPVDSQQDLRTEMVLKMMEVGIPVECQHHEVATAGQAEID
FT                   MKASTLVKMADNLQWYKYVVKNVARRFGKTVTFMPKPLYGDNGSGMHIHMSIWKEGKPM
FT                   FAGDKYAGLSEMALFAAGGVLKHAAAICAITNPTTNSYKRLVPGYEAPVNLAYSSRNRS
FT                   ASVRIPMYSASPKLKRMEVRFPDPSCNGYLAFSALLMAALDGIENRIDPGEPLDRDIYS
FT                   MTPEELADVPSTPGSLDAALNALESDHEFLLKGDVFTEDVIEKWIEYKRLNEVDPIRMR
FT                   PHPHEFKLYFDV"
     atgaccccga aagaagttct ggcgtatgca aaacagaacg gcgccaagat ggtggatttc        60
     aaattcatgg atttcgtagg gacctggcag cacttcacga accccatcga tgagctcggc       120
     gaatccgatt tcgaaaacgg ctacggtttc gacggttcga gtatccgcgg gtggcagccg       180
     atccacgcca gcgacatgct gatcatcccg gatccgacga cggcgaaaat ggatcccttc       240
     atggccgttc ccaccctgac catgatctgc gacgtggtgg acccggtgac caaggagcgc       300
     tacaccaggg atccgcgcta catcgcgcac aaggccgagg aatacctcaa gttcacgggg       360
     atcggcgacg ccgcgtggtt cggccccgaa gcggaattct tcattttcga cgacatacgc       420
     ttcgacgacg gctgccagtt cggctactac cacatcgatt ccgtggaagg gatctggaac       480
     agcggccgcg tggaaaaccc caacctcggg tacaagcccc gtcacaagga aggatacttc       540
     ccggtccctc cggtggattc acagcaggac ctgcggaccg agatggttct caagatgatg       600
     gaagtgggaa ttcccgtcga atgccagcat catgaagtgg ccaccgccgg gcaggccgaa       660
     atcgacatga aggcgtccac cctggtgaag atggccgaca acctgcagtg gtacaagtac       720
     gtggtcaaga acgtggcgcg ccgtttcggc aagaccgtca cgttcatgcc caagccgctc       780
     tacggcgaca atggttccgg gatgcacatc cacatgagca tctggaagga aggcaaaccc       840
     atgttcgcgg gcgacaagta cgccgggctg agcgaaatgg ccctgttcgc cgccgggggc       900
     gtgctcaaac atgcggccgc gatctgcgcc atcaccaacc ccacgaccaa ttcgtacaaa       960
     cggctggtgc cggggtacga agcgccggtg aacctcgcct actcgagcag aaaccgcagc      1020
     gcctcggtgc ggatacccat gtattcggca tcgcccaagc tcaagcgcat ggaagtccgg      1080
     ttccccgatc cgtcctgcaa cggttacctg gcgttcagcg ccctgctgat ggccgccctc      1140
     gacggcatcg aaaaccgcat cgatccgggc gaaccactgg atcgcgacat ctactccatg      1200
     accccggaag aactggccga tgtgccctcg acgccgggtt cgctcgacgc ggcgctcaat      1260
     gccctggaaa gcgatcacga attcctgctc aaaggcgacg tgttcaccga ggacgtcatc      1320
     gaaaagtgga tcgaatacaa acggctgaac gaagtggatc cgatccgcat gagaccgcat      1380
     ccgcacgagt tcaaactcta cttcgacgtc taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page