(data stored in ACNUC7421 zone)

EMBL: CP000478.PE572

CP000478.PE572       Location/Qualifiers
FT   CDS_pept        703428..704192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0577"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: sat:SYN_01193 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16276"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS4"
FT                   /protein_id="ABK16276.1"
FT                   /translation="MSEDAKPKCIAELSQGQLVRWVIEGLRCTMIHYGYWFREVESRLG
FT                   FERAAEAEATAGDRVLGIVMRRLGAAMGFEVDDRGYPAALTAMSREELLNLIDAVCANW
FT                   LANDGVWFREVEKPFGMVSAKHANDMCWGRFSLYEAFRIKRFLELPKLPGLDGLKTALA
FT                   FRMYSRINKQSIEDVDEHSFIFRMEECRVQMARKRKGLPDYPCKSAGMIEYPYFASAID
FT                   PGIETECIGCPPDRHPEGWFCAWKFMLKPRGR"
     atgtcggagg acgccaaacc gaaatgcatt gcggaactgt ctcagggcca actggtgcgc        60
     tgggtgatcg aggggcttcg gtgcaccatg atccactacg gttactggtt cagggaggtt       120
     gaaagccggc tcggtttcga gcgggccgcc gaggcggagg ccacggcggg ggacagggtg       180
     ttggggattg tgatgagaag gctgggagcc gccatgggct tcgaagtcga tgacaggggt       240
     tatcctgccg ccctcaccgc catgagcagg gaggagcttc tgaacctcat cgatgcggtc       300
     tgcgccaact ggctggcaaa cgacggggtc tggttccggg aggtagaaaa acccttcggc       360
     atggtcagtg cgaagcacgc caacgacatg tgctgggggc ggttttcgct ctacgaggcc       420
     ttcaggatca agaggttcct cgagctgccc aagctgccgg gactggacgg cctcaagacc       480
     gccctggcgt tccggatgta ctcgaggatc aacaaacaga gcatcgagga cgtggacgaa       540
     cacagtttca tcttccgcat ggaggaatgc cgcgtgcaga tggcccgcaa gcgcaagggg       600
     cttcccgatt acccctgcaa gtcggcaggg atgatcgagt atccctactt cgcctcggcc       660
     atcgatcccg gcatcgaaac ggaatgcatc ggctgcccgc cggacaggca tccggagggc       720
     tggttctgtg cgtggaagtt tatgctcaaa ccccggggtc ggtga                       765
//

If you have problems or comments...

PBIL Back to PBIL home page