(data stored in ACNUC7421 zone)

EMBL: CP000478.PE576

CP000478.PE576       Location/Qualifiers
FT   CDS_pept        706395..708641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0581"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: bja:bll1715 two component regulator; TIGRFAM:
FT                   PAS sensor protein; PFAM: ATP-binding region, ATPase domain
FT                   protein domain protein; histidine kinase A domain protein
FT                   domain protein; PAS fold-3 domain protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16280"
FT                   /db_xref="GOA:A0LFS8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFS8"
FT                   /protein_id="ABK16280.1"
FT                   /translation="MRSMEHAGKAAAFLFLGLLFLAVSHGSSASVPVKRILLLFPFESS
FT                   VPGFISYDNSLRSTLTASKDYQFEFYVECMDLTRFTSKDYRDKLVGLYREKYSGIEIDL
FT                   VVALLRPSLDFVAEHSPETFQNVPVIVVEQDPRLLGDLPSTSLAAVVTGKLDMEGTLAL
FT                   ALRLHPDARKVFVVSGVSRYDELVHGLAREGFRGFENQVDLQYLSGLPMDELIDRVAKV
FT                   PEHSLVFYLTVTRDGSGKTFRSPEALALLSRQANAPIYSISETYIDYGIVGGHLVSQSV
FT                   LGVRTAQAVLRTLGGERPGDRESSEGGANRYIFDARELKRWGVGEENLPQGSILRHRDF
FT                   SLWREYRWQIVGVFLIVFIQAFLISALFVSRGKQLRADRALRNAESKYRTVADYTYDWE
FT                   DWSAPDGSLNYVSPSCKRITGYSPQEFIENPSLRHEIIIPEDRHIWDRHKAGIGPESES
FT                   REIQFRILTRAGETRWIDHTCRSVTDQNGDFLGIRASNRDVTERRMAEARVQRHRDELS
FT                   HISRVAALGELAGSLAHELNQPLAAILNYANAARRFLAAAEPNLSKVSEALQGIIRDEK
FT                   RAAQVIREVRALIRKQEPHYRALSINKVIRKSVDLFRGDSILTGLSIVTELAPGLPAVR
FT                   GDGVQLQQVLINLTLNAVAAMSGVLPDSPRLVFRTEAWEDQGVKVSIRDFGAGIDEDHK
FT                   DRLFEPFYTTRPEGLGMGLAICRNIIDAHGGTMGAENNPDGGATFYFTLQAAAR"
     atgagatcca tggagcatgc agggaaagcc gccgcatttc tgtttcttgg actcctgttt        60
     cttgcggttt ctcacggctc atcggcatcg gtgcccgtta agaggatctt gcttctcttc       120
     ccgtttgaga gcagcgtgcc cgggttcatc agttacgaca acagccttcg atcaacattg       180
     acagcctcga aggattacca gttcgagttc tacgtcgaat gcatggatct gacgaggttc       240
     acgagtaagg actatcgcga taagctcgtc ggactgtacc gcgagaaata ctccggcatc       300
     gaaatcgacc tcgttgttgc cttgctgcga ccatctctcg atttcgtggc ggaacacagc       360
     cccgaaacgt ttcagaatgt ccctgtcatt gtcgtcgaac aggaccccag gctccttggt       420
     gacctcccat cgacatccct tgccgcggtg gtgaccggca agctggatat ggaggggacg       480
     ctggctctcg cgctccgcct gcatcctgac gcccgcaagg ttttcgttgt aagcggggtc       540
     tcgcgatacg acgaattggt tcacggattg gccagggaag gctttcgcgg tttcgaaaac       600
     caggttgatc tccagtacct ctccgggctc cccatggatg agctcatcga tcgagttgcg       660
     aaggttcccg agcactccct ggtgttttac cttactgtca cccgggatgg cagcggaaag       720
     acctttaggt cccccgaggc tcttgccctc ttgtccaggc aggcgaacgc acccatttat       780
     agtatatccg aaacatacat cgattacggg attgtaggcg gccatcttgt cagtcaatcc       840
     gtcctgggag tcaggacggc ccaggcagtg cttcggaccc tcggcgggga aaggcccggc       900
     gacagggagt cttccgaggg aggtgcgaat cggtatattt ttgacgcgcg cgagctcaag       960
     cggtgggggg tcggggagga aaacctccct caaggcagca ttctgcgcca cagggatttt      1020
     tccctttgga gagaataccg gtggcagatc gtcggggttt ttttgattgt cttcatccag      1080
     gcgttcctca tatccgccct cttcgtaagt cgtgggaagc agctccgggc tgatcgcgct      1140
     cttcgaaacg cggaatcgaa gtatcggaca gttgccgact acacctatga ttgggaggac      1200
     tggtcggccc cggatgggag cttgaattat gtatccccct cctgcaagcg cattacggga      1260
     tacagcccgc aggaatttat cgaaaaccca tctcttcgcc atgagatcat catcccggaa      1320
     gatcgccaca tctgggatcg acacaaagcg ggcattggac ccgaatcgga gtcgcgggaa      1380
     attcagttcc gcatactcac ccgcgccggc gaaacccgct ggatagacca cacttgccgg      1440
     tcggtaaccg atcagaatgg tgacttcctg ggtatccggg caagcaacag ggatgtgacg      1500
     gaaaggagga tggccgaagc cagggttcag cgacaccggg acgagctttc ccatatttcg      1560
     cgggtggccg ccctcgggga gctcgccggt tctcttgctc acgagctcaa tcagcccctg      1620
     gcggcgatac tcaactacgc caacgccgca cggcgatttc ttgccgctgc cgaacccaat      1680
     ttgagcaaag tcagcgaagc ccttcaaggc atcatccggg atgaaaaaag ggcggcccag      1740
     gtgatccgcg aagtccgggc cttgattaga aagcaggaac cccactaccg tgcactgagc      1800
     ataaacaaag tcatccggaa atccgtcgat ctctttcgag gcgattcgat cctgacgggg      1860
     ttgtctatcg tgaccgagct cgcgccgggg ctgcccgcgg ttcggggcga cggggttcaa      1920
     ctgcagcagg tactcataaa cctcaccttg aatgctgttg ccgccatgag cggtgttctg      1980
     ccggattccc cccggctggt cttcaggacc gaggcctggg aagatcaggg cgtgaaagtc      2040
     tcaatcagag attttggcgc gggcattgac gaggatcata aggatcggct ttttgagccg      2100
     ttttacacga ccagacccga agggttggga atggggctcg ccatctgccg aaacattatc      2160
     gatgctcatg ggggcacgat gggggccgag aataatcctg acggaggagc aactttctat      2220
     tttactctac aggctgccgc aagatga                                          2247
//

If you have problems or comments...

PBIL Back to PBIL home page