(data stored in ACNUC7421 zone)

EMBL: CP000478.PE578

CP000478.PE578       Location/Qualifiers
FT   CDS_pept        709512..709883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0583"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   aba:Acid345_3714 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16282"
FT                   /db_xref="GOA:A0LFT0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT0"
FT                   /protein_id="ABK16282.1"
FT                   /translation="MTWKQCTVFVADDDKSVLESLALLLESAGYQSRGFGSAEELLASG
FT                   SVQNACCLILDIKLPGMSGLQLLQVLAASHTPIPVVFITGHDCPGIEAQALGLGAVAYL
FT                   RKPFDEQMLLDAIHPYCVN"
     atgacctgga aacaatgcac tgtctttgtc gcagatgacg acaagtccgt cctcgagtct        60
     ctggcgctcc tgctcgaatc ggcaggatat caaagcaggg ggttcggctc cgcggaggag       120
     ttgcttgcat ccggctcggt gcaaaacgcc tgctgcctca ttctggacat caaactgccc       180
     ggaatgagcg ggcttcagtt gttgcaggtc ctcgccgcgt cacacacccc gattccggtg       240
     gtcttcataa ccggccacga ctgtcccggg attgaagcgc aggccctggg gcttggagct       300
     gtcgcctatc tccggaagcc gttcgacgag cagatgcttc tcgatgcgat tcacccgtac       360
     tgcgtgaatt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page