(data stored in ACNUC7421 zone)

EMBL: CP000478.PE585

CP000478.PE585       Location/Qualifiers
FT   CDS_pept        716855..717346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16289"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFT7"
FT                   /protein_id="ABK16289.1"
FT                   /translation="MMKKHKVVLTVFLIAAVVLAAAPVPAQEKAADNMQIVLEKARADK
FT                   KLLVAGNMQLTEAEGKVFWPVYERYQDELFLLRARTLKLLDDYADSYEKLTNEMAKKLL
FT                   DEYMTIETLRLKLHQAYLPKFRKALPDKKVARYYQIENKVQAALMYEFARKIPLAKTDG
FT                   "
     atgatgaaga aacacaaagt ggttctaacc gtttttctga ttgcagccgt tgtgctggct        60
     gccgcccctg tgcccgctca ggaaaaagcg gcggataaca tgcagatcgt cctcgaaaag       120
     gcccgcgccg acaagaaact cctggttgca gggaacatgc agctcacaga ggccgaaggg       180
     aaagtcttct ggccggtcta tgaacgatat caggatgagc tgtttcttct tcgcgcacga       240
     actctcaaat tgcttgacga ttatgcggat tcctacgaaa agctgaccaa cgaaatggcc       300
     aaaaagctgc tcgacgagta tatgaccatt gagactttgc ggctgaagct ccaccaggcc       360
     tacttgccca agttccgaaa ggctctgccc gacaaaaagg tcgcccgata ttaccagata       420
     gagaacaagg tccaggctgc tctaatgtat gaatttgccc gcaaaatacc gctggcaaaa       480
     acggatggct aa                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page