(data stored in ACNUC7421 zone)

EMBL: CP000478.PE588

CP000478.PE588       Location/Qualifiers
FT   CDS_pept        719119..720249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0593"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   mca:MCA0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16292"
FT                   /db_xref="GOA:A0LFU0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU0"
FT                   /protein_id="ABK16292.1"
FT                   /translation="MNIPSQSDYEFEQRVASRFMDILIRAGLILVLAMLCYQVLSPFLT
FT                   LMVWALILAVTIFPLHQFLAGRIGGRQGLAAALLVIVGLMLIVVPTAMLMSSLGDSVHQ
FT                   LVNDVQNNSLKIPAPRPGVEGWPVVGKKVHDIWSRAYADLPALVQSMQPKIGELAKTAL
FT                   GFVAGIAGGLLQFIASFIVAGIIMAFGQSGGRGSLAIFERIVGRERGGEFARLSTSTIR
FT                   AVSQGVIGVAFIQAIIVGLALLVSGVPWAGALALIVLVLGIAQIPALIVTLPAIVYIWM
FT                   SGHYGNAAAVAYTVVLILSGMTDNVLKPLMLGRGVDAPMPVILLGALGGMGTAGILGMF
FT                   VGATLLTLGYQVFMGWVAANPDAGQAQAESESQQAG"
     atgaacatac cctcccagtc tgattacgag ttcgagcagc gggtggcctc ccgctttatg        60
     gatatcctga tccgtgccgg cctgatcctc gtcctggcca tgctttgcta ccaagtgctc       120
     tccccgttcc tgacgctgat ggtctgggcg ctcattctgg ccgttacgat ctttcccctc       180
     caccaattcc tggcgggcag gatcgggggc aggcaaggac ttgccgcagc cctgctggtc       240
     atcgtcggcc tcatgctgat cgttgtgccg acggcgatgc tgatgagttc acttggcgat       300
     tcggtgcatc agctggtcaa cgacgtgcag aacaactcgc tgaagattcc ggcaccgcgt       360
     cccggcgtgg agggatggcc ggtcgtcggc aagaaggtcc acgacatctg gtccagggca       420
     tatgccgacc tgccggcact ggtgcagagc atgcagccga agattggaga actggcgaag       480
     acagcactgg gcttcgtcgc cggcatcgcc ggtggattgt tgcagttcat agcctcgttc       540
     atcgtcgccg gcatcatcat ggccttcggg cagtcgggcg gtcgcggcag cctggcgatc       600
     ttcgagcgca tcgtcggcag agagcgaggc ggcgaatttg cgagactgtc cacgtcgacc       660
     attcgtgccg tctcccaggg ggtcatcggt gtggccttca ttcaggccat catcgtcggc       720
     ctggctctgc tggtctccgg ggtcccgtgg gcgggtgcgc ttgcgttgat cgtgctggtt       780
     ctcggtatcg cccagattcc ggcgttgatc gtgaccctgc ccgcaatcgt gtacatctgg       840
     atgagcggtc attacggcaa cgcggcagcg gttgcttaca cggtggtgtt gatcctctcg       900
     ggaatgacgg acaacgtgct gaagccgctg atgctgggaa ggggggtcga tgctccgatg       960
     ccggtgatcc tgctcggcgc gctgggcggc atggggaccg ccgggatcct ggggatgttc      1020
     gtcggcgcca ccttgctgac gctgggctac caggtcttta tgggttgggt ggcggccaac      1080
     ccggatgccg ggcaggcgca ggcggaaagc gagtcgcagc aggcgggcta a               1131
//

If you have problems or comments...

PBIL Back to PBIL home page