(data stored in ACNUC7421 zone)

EMBL: CP000478.PE592

CP000478.PE592       Location/Qualifiers
FT   CDS_pept        722596..722946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0597"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16296"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU4"
FT                   /protein_id="ABK16296.1"
FT                   /translation="MKGVAGIEPEAPGMPLPRRENREPESLQKPGCAHHVPAVRRVRPA
FT                   GVASARVCRTSSSCTARRAGPFLFPHDSVPRHNLSSSFGGIRLRQRFLTVQSSYRPLPI
FT                   LSPCSDGHRSQS"
     ttgaaaggtg tcgcaggcat cgaaccggaa gcgcccggca tgccgcttcc tcgccgtgag        60
     aaccgggaac cggaaagcct tcagaagccg ggatgcgctc atcatgtgcc tgcggtccgc       120
     cgggtcaggc ctgccggcgt cgcctccgcg cgggtatgcc gcacgtcgtc ctcctgcacg       180
     gcccgacggg ccggtccgtt tctctttcca cacgacagcg ttccccggca caacctgtct       240
     tcatcgttcg ggggcatccg tctccgacag cggtttctga cggtgcaatc ttcataccgg       300
     ccgctgccga tcctttcgcc ttgttccgat ggtcaccggt cccagtcatg a                351
//

If you have problems or comments...

PBIL Back to PBIL home page