(data stored in ACNUC7421 zone)

EMBL: CP000478.PE594

CP000478.PE594       Location/Qualifiers
FT   CDS_pept        complement(724110..724682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0599"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2; KEGG:
FT                   bte:BTH_I1723 RNA polymerase sigma-H factor"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16298"
FT                   /db_xref="GOA:A0LFU6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU6"
FT                   /protein_id="ABK16298.1"
FT                   /translation="MEEDRAVIARIKNGDTGAFAVLVQKYQGRLLTFIHRMVRDGKIVE
FT                   DIGQEVFLDVYKSLRNFDETRGTPFSAWLFIAARNRCVNELRKRTGEHCVHIDAVDAAD
FT                   LGVDLRTAEHLLLEHERRSALRDSLAKISEPLRKPIFMWLNGGSLAEIAEACGVSPGTV
FT                   KSRLFRAREKVRVCVQHQAGGKNHDGV"
     atggaagaag accgcgcggt catagccagg ataaagaacg gggataccgg agcgtttgcc        60
     gtgctggtgc aaaagtacca gggaaggctt ctgaccttta tccaccgcat ggtccgggac       120
     gggaagatcg tggaagacat cggccaggaa gtctttctgg acgtgtacaa atccttgagg       180
     aactttgatg aaacacgagg aactcccttt tctgcctggc ttttcatcgc ggcgcgcaac       240
     cgttgcgtga acgagttgcg gaagagaacg ggagagcatt gcgttcatat cgacgcggtg       300
     gatgccgccg atctcggagt ggacctgcgg acggcggagc acctgctcct ggaacatgag       360
     aggcgaagcg cgctccggga ttccctggcg aaaatttcgg aaccgttgcg caagccgatt       420
     ttcatgtggc tcaacggcgg ttccctggcg gagatcgccg aagcgtgcgg ggtgtcgccg       480
     ggaacggtga aatcgaggct cttcagagcc agggaaaagg taagggtctg cgtgcagcac       540
     caggcgggag gcaagaacca tgacggagtt tga                                    573
//

If you have problems or comments...

PBIL Back to PBIL home page