(data stored in ACNUC7421 zone)

EMBL: CP000478.PE597

CP000478.PE597       Location/Qualifiers
FT   CDS_pept        complement(726572..726946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0602"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rba:RB8370 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ABK16301"
FT                   /db_xref="GOA:A0LFU9"
FT                   /db_xref="InterPro:IPR011429"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0LFU9"
FT                   /protein_id="ABK16301.1"
FT                   /translation="MPVFVRIVLLGSAVLLLVLTGTQPRTDAASPVYADVAKIFQKHCT
FT                   SCHSGARAPDKFRMETYMDVMQGGRNGAMVLPGDPAGSEIIRRVKGASTPRMPKNGPPW
FT                   LSADEVRVLEKWVENGAPEA"
     atgccagtat tcgtcagaat cgttttgctc gggtcggccg ttctccttct ggttctgacc        60
     ggcactcagc cccggaccga cgcggcgtcc cccgtttacg ccgacgtggc caagattttc       120
     caaaaacact gcaccagttg ccacagcggc gctagagcgc ctgacaagtt tcgcatggag       180
     acttacatgg atgtgatgca gggcggtaga aacggtgcga tggttctgcc cggcgatccg       240
     gccgggagcg agatcatcag gcgggtcaag ggcgcgagca cgccccgcat gcccaagaac       300
     ggcccgccat ggctttccgc cgatgaggtc cgtgtccttg agaaatgggt tgaaaacggt       360
     gcccccgagg cctag                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page