(data stored in ACNUC7421 zone)

EMBL: CP000478.PE61

CP000478.PE61        Location/Qualifiers
FT   CDS_pept        complement(77970..78908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0062"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /note="KEGG: dps:DP0437 probable ornithine
FT                   carbamoyltransferase; TIGRFAM: ornithine
FT                   carbamoyltransferase; PFAM: aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding region;
FT                   aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15765"
FT                   /db_xref="GOA:A0LEB3"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB3"
FT                   /protein_id="ABK15765.1"
FT                   /translation="MKRDLLSIRDLSADEIVALISRAETMKRELAEGNLRQSLRNKVVA
FT                   LIFVKPSTRTRVSFEAAIYRLGGHSIFMSARDTQISRQEPLADTARVLARYVDAIVIRT
FT                   FAQEDVTELARYASIPVINGLTDRTHPCQVLGDLLTIKEKRGTLEGLHVAWIGDGNNVA
FT                   HSWINAAARLGFTVSLACPSQYLPDREILDWADTQGKGKVIMAASPKEAVASADAIYTD
FT                   VWASMGQEEEADARRSIFRPFQVNEELLSAAPAHAIVLHCLPAHRGEEITNAVMEGPHS
FT                   AIFDQAENRLHIQMALLDWLLSDNAPTQGSK"
     atgaagcgcg atctgctttc catcagggat ctcagcgctg atgaaatcgt cgcactgatc        60
     tcgagagcgg agaccatgaa gcgggaactg gccgaaggga atctgcggca gtctctcagg       120
     aacaaggtcg tagctctgat cttcgtgaaa ccgtccacgc gcacccgggt ctctttcgag       180
     gcggcgatct atcgtttggg tgggcacagc atcttcatga gtgccaggga cacgcagatc       240
     tcgaggcagg aaccgctggc ggatacggcc cgagtgctgg cgcgatacgt ggatgccatc       300
     gtcataagga ctttcgccca ggaagacgtg accgagctgg cccgctacgc gtccattccg       360
     gtgatcaacg ggctcacgga ccgcacccat ccctgtcagg tgctgggaga tctgctcacc       420
     atcaaggaaa agcgggggac cctcgagggt ctgcacgtgg cctggatcgg cgacggtaac       480
     aacgttgccc actcgtggat caacgcggcg gccagactcg gtttcaccgt atcgctggcc       540
     tgcccgtccc agtatcttcc ggaccgggag attctcgact gggccgatac ccagggcaag       600
     ggcaaggtga tcatggccgc gagccccaaa gaggcggtgg cgtcggccga cgctatctac       660
     accgacgtgt gggcgagcat ggggcaggaa gaggaagccg atgcccgcag gtcgatcttt       720
     cgcccgttcc aggtcaacga agaactcctg tcggcggccc ccgctcacgc catcgttctc       780
     cactgcctgc cggcgcatcg cggcgaagag atcaccaacg cggtcatgga gggtccgcat       840
     tccgccatct tcgaccaggc ggaaaacagg ctccacatcc agatggcgct gcttgactgg       900
     cttttgagcg acaacgcccc gacacagggg agcaagtaa                              939
//

If you have problems or comments...

PBIL Back to PBIL home page