(data stored in ACNUC7421 zone)

EMBL: CP000478.PE63

CP000478.PE63        Location/Qualifiers
FT   CDS_pept        complement(80165..81061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0064"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: sat:SYN_02154 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15767"
FT                   /db_xref="GOA:A0LEB5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB5"
FT                   /protein_id="ABK15767.1"
FT                   /translation="MIEKAGILIEALPYIRRFYGKTVVIKYGGNAMVAEELKESFAKDI
FT                   VLMKYIGINPVVVHGGGPQIGRMLKRIGKESDFCAGMRVTDADTMDIVEMVLAGKINKE
FT                   IVSLINRHGGHAVGLSGKDGNLIEARKLHVYRYKGDDQPPEIIDIGLVGEVNRVNVSIL
FT                   DTLAGGNLIPVIAPVGVGEQGETYNINADLVAGHIAGALQAAKLVLMTDVEGVLDGGGN
FT                   LISSLTVAEAADALQDETLKGGMIPKVQCAIDALQSGVDKVHIVDGRVPHAILLEIFTD
FT                   AGVGTEIVRYRRGQSVG"
     atgatcgaaa aagccggcat tttgatcgaa gccctgcctt acatccggcg cttctacggg        60
     aagaccgtgg tgatcaagta cggagggaac gcgatggtgg ccgaagagct caaggagagc       120
     ttcgccaagg acatcgtttt gatgaaatac atcgggatca accccgtggt ggtccatggc       180
     ggcgggcctc aaatcggccg gatgctcaag aggatcggca aagagagcga tttctgcgcc       240
     gggatgcgcg tcaccgatgc ggacaccatg gacatcgtgg agatggtcct tgccggaaag       300
     atcaacaagg agatcgtgtc gctcatcaac cgtcacggcg gtcacgccgt cggattgagc       360
     ggcaaggacg ggaatctcat cgaagcgcga aagctccacg tgtatcggta caaaggcgat       420
     gaccagccgc ctgaaatcat cgatatcggc ctcgtggggg aagtgaaccg tgtgaacgtg       480
     agcattctgg acaccctggc aggaggcaac ctgatccccg tgatcgctcc ggtcggcgtc       540
     ggggaacagg gtgaaaccta caacatcaac gccgacctcg tcgcgggcca catcgccggc       600
     gccctgcaag ccgccaagct cgtgctgatg acggacgtcg agggagtgct cgatggaggc       660
     gggaacctca tttccagcct gaccgtggcc gaggccgccg atgcgcttca ggatgagacc       720
     ttgaagggcg ggatgatacc caaggtgcaa tgcgccatcg acgccctgca gtcgggggtc       780
     gacaaggttc atatcgtgga cggccgggtg ccgcacgcca tcctgctgga aatattcacc       840
     gacgccgggg tcggaacgga aatcgtgcgc taccggcgcg gacagtccgt aggttga          897
//

If you have problems or comments...

PBIL Back to PBIL home page