(data stored in ACNUC7421 zone)

EMBL: CP000478.PE64

CP000478.PE64        Location/Qualifiers
FT   CDS_pept        complement(81161..82561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0065"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: sat:SYN_02153 ATP-dependent endopeptidase hsl
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15768"
FT                   /db_xref="GOA:A0LEB6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB6"
FT                   /protein_id="ABK15768.1"
FT                   /translation="MQKPLTPAEIVQELDKYIIGQRDAKRMVAIALRNRWRRQQVPEHL
FT                   RDEIAPKNIIMIGPTGVGKTEIARRLARLAQSPFLKIEASKFTEVGYVGRDVESMIRDL
FT                   SELAVSMVRTEEMEAVKIKAEELAEEKLLDILLPPKRQQESREQELPVPVEPQEAREPR
FT                   EAAREEAVQADSTREKLRKLLRKGALDDRYVELDVPDRNFPMVEIFAGTGMEDMDYNLR
FT                   DMLGSMLPRRTKRRKVKIPEAREILVQEESQRLIDMDKVIKSAIERVEHSGIIFLDEID
FT                   KIAGRESGGRGPDVSREGVQRDLLPIVEGSTVTTKYGMVKTDHILFIASGAFHISKPSD
FT                   LIPELQGRFPIRVELASLTKEDFVRILKEPENALIVQYKSLLATEEVELTFDDEAIEEI
FT                   AGLAFQVNARTENIGARRLHTIMEKLLSDISFNAPDLKGQKIPITRQYIQETLSDIIKD
FT                   EDLSRYIL"
     atgcaaaaac cgctgacgcc tgcggaaatc gttcaggaac tggacaagta catcatcggg        60
     caacgagacg ccaaacgcat ggtcgccatc gccctgcgca acaggtggcg tcgacagcag       120
     gtccccgagc acctcaggga tgagatcgcg ccgaagaaca tcatcatgat cggccccacc       180
     ggcgtgggga aaacggagat tgcacgccgc ctggccagac tggcccaatc gccgtttctc       240
     aagatcgagg cgagcaaatt caccgaggtg ggttatgtcg gccgtgatgt ggaatccatg       300
     atcagggacc tctcggaact cgcggtcagc atggtgcgga cggaggaaat ggaagcggtc       360
     aagatcaagg cggaggaatt ggccgaagag aagctcctcg atatcctgct cccgcccaaa       420
     cggcagcagg agtccaggga acaggaactg ccggtcccgg tggagccgca ggaggcgcgc       480
     gagccccggg aggccgcccg ggaagaagct gtccaggccg actccacgcg cgaaaagctg       540
     cgcaagctac tgcgcaaggg cgccctcgac gaccgctacg tcgagttgga cgttccggac       600
     cgcaatttcc ccatggtcga aatctttgcc gggaccggga tggaggacat ggattacaac       660
     ctgcgcgaca tgctcgggtc catgctgccc cggcgcacca agcggcgcaa ggtgaagatc       720
     ccggaagccc gcgagatact ggtccaggag gaatcccagc ggctcatcga catggacaag       780
     gtgatcaagt ccgccatcga gagagtcgag cactccggca tcattttcct cgatgaaatc       840
     gacaagattg ccgggcggga atccggcgga cgcggacccg acgtgtcccg cgaaggggtc       900
     cagcgggatc tgctgcccat tgtggaaggc tccacggtca ccaccaagta cggcatggtc       960
     aagaccgatc atatcctgtt catcgcctcc ggggcctttc atatttccaa gccctcggac      1020
     ctcattcccg agcttcaggg ccggttcccc atcagggtcg agctcgcttc cctgacgaag      1080
     gaggatttcg tccgcatcct caaggaaccg gagaacgcgt tgatcgttca atacaagtcg      1140
     ctgctggcca cggaggaggt tgagctcact ttcgacgatg aagccatcga agagatcgca      1200
     ggtctcgctt tccaggtcaa cgcgagaacg gagaacatcg gagcgagacg actgcatacc      1260
     atcatggaga aattgctgtc cgacatttca ttcaacgcgc cggatctgaa gggccaaaag      1320
     ataccgatca cgcggcaata cattcaggaa accctgagcg acatcatcaa ggacgaggac      1380
     ctgagccgct atattcttta g                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page