(data stored in ACNUC7421 zone)

EMBL: CP000478.PE66

CP000478.PE66        Location/Qualifiers
FT   CDS_pept        complement(83198..84184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0067"
FT                   /product="phage integrase family protein"
FT                   /note="PFAM: phage integrase family protein; phage
FT                   integrase domain protein SAM domain protein; KEGG:
FT                   pca:Pcar_0623 site-specific recombinase, phage integrase
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15770"
FT                   /db_xref="GOA:A0LEB8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0LEB8"
FT                   /protein_id="ABK15770.1"
FT                   /translation="MAPGTLDDNSADGSEATWSEASARFIAHLRHERGLSAETVRAYAG
FT                   DLDQFREHMNATAGTADPRLSQVDADAIRGYLAALHKTRKKTSRARKLSTLRSFYHFLN
FT                   DRELVRENPAALVAYPKLGTKIPSFLGVDDVFHLLDSLNAGAARAGASWRRCRNWALFE
FT                   CMYSTGVRVSELAGMDESDVDFHEGMVRVLGKGSKERIVPVGGKALDAVKLYLRVLDSQ
FT                   FPEARRMGSALFRNARGRRLTTRSVHRLLRMELRRCGLWQHLSPHGLRHTFATHLLNSG
FT                   ADLRAIQEMLGHSNLSTTQRYTHVHVDQLMKVYDAAHPRSRRDRSGK"
     ttggcgcccg ggactcttga cgataactcc gccgacggca gcgaggcgac ctggtcggag        60
     gcatcggccc gattcatcgc gcacctgcgg cacgagcgcg gattgagcgc cgagacggtg       120
     cgggcttacg ccggcgacct ggatcaattt cgggaacaca tgaacgcaac ggcgggcaca       180
     gccgatccga ggctgtcaca ggtcgacgcg gatgcgatca gggggtatct cgccgcgttg       240
     cacaaaaccc gcaagaagac cagccgggcc aggaaattgt ccacgttgcg ctctttctac       300
     cattttctca atgaccgcga gctcgtccgc gagaatcccg cggcccttgt ggcctatccc       360
     aagctgggga cgaaaatccc ctccttcctc ggggtcgacg acgtgtttca tttgctggac       420
     tcgctgaacg ccggagcggc ccgggccggc gcatcctggc ggcgctgccg caactgggcg       480
     ctttttgaat gcatgtactc caccggagtc cgggtcagcg agcttgccgg gatggacgaa       540
     tccgacgtcg atttccacga gggcatggtc cgggtcctgg gtaaagggag taaagagcgc       600
     atcgtgccgg tgggagggaa ggcccttgac gccgtgaagc tctacctgcg ggtgctggac       660
     agccagttcc cggaagccag gcgcatgggt tccgcgctgt ttcgcaacgc cagggggcgg       720
     agactgacga cgcgttcggt gcaccggctg ctccgcatgg agctccgaag atgcggactg       780
     tggcagcatc tcagcccaca cgggttgcgg cacacgttcg cgacccacct gttgaactcg       840
     ggagcggatc tgcgcgccat tcaggagatg ctgggacact cgaacctgtc cacgacgcaa       900
     cgctacactc atgttcacgt ggaccagctc atgaaggtct acgatgcggc ccaccccaga       960
     agccgcaggg atcggtcggg aaagtaa                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page