(data stored in ACNUC7421 zone)

EMBL: CP000478.PE67

CP000478.PE67        Location/Qualifiers
FT   CDS_pept        84698..86773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0068"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor, GTP-binding; elongation
FT                   factor Tu, domain 2 protein; elongation factor G, domain
FT                   IV; KEGG: sat:SYN_02930 protein translation elongation
FT                   factor G"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15771"
FT                   /db_xref="GOA:A0LEB9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEB9"
FT                   /protein_id="ABK15771.1"
FT                   /translation="MKEDVAGVRTFAIISHGGAGKTSLAEAMLFDAGVTTRLGKVDDST
FT                   SVMDYEPEEVKRKITISTAFNTLTWKKHQFTIIDTPGDFNFIAETKTSMQGADAVLVLV
FT                   DAIDGVRVQTEKVWEFADEFKQPRIIFVNKMDRERADFAKTVADIQNNFGKSCVPLQIP
FT                   IGSAESFKGVVDVLNRKACLYGHGDSGKFEVKEMPADLADQVAHYHEELVERVAESNDE
FT                   LLEKYLESGELSPEEVKNALRGAVTSGTLVPIACGSGVANIGIHGLMDLIADCLPSPLD
FT                   RGPRTGKGARGAEADREPDPAAPFSALVIKTISDPYAGRLSVMRVFSGSLSPDSTVFNS
FT                   TKETKERFGQLLRLKGKNQEPIQGCGPGDVVAVAKLKETTTQDTLCSEKDVISFPPVEL
FT                   PPAIYSLAVEPKSKGDEEKIFSSLSRLMEEDLTLKLERNEETKEMILSGMGEIHIEATV
FT                   DKLKRKFGVEVNLRIPKVTYKETIKGKARVQGKYKKQSGGRGQYGDCWIEMEPLPRGEG
FT                   FQFYDKIVGGVIPRQYIPAVEKGIAEALVEGALAGYPVVDFKVDLVDGSFHPVDSSEMA
FT                   FKIAGSMAFKKAMMEAKPTLLEPIVLMEITVPDDCMGDIIGDLNSRRGRVLGMESKGKK
FT                   QIVRANVPLAEVLKYAPDLRSMTAGRGMFTMKFSHYEEVPGQLQEKIVEAAKAEEK"
     atgaaagagg acgttgcagg tgttcgtact ttcgcaatca tttcccatgg tggtgcgggc        60
     aagacttccc tggccgaggc catgctcttc gatgccggtg tgaccacccg gctcggcaag       120
     gtggacgaca gcacctcggt catggactac gaacccgagg aggtgaagcg gaagattacg       180
     atcagcaccg cattcaatac cctgacctgg aagaaacacc agttcaccat catcgatact       240
     cccggggact tcaatttcat cgcggaaacc aagacatcca tgcagggtgc ggatgccgtc       300
     ctcgtcctgg tcgacgccat cgacggcgtc agggtccaaa ctgaaaaagt gtgggaattt       360
     gccgacgaat tcaaacagcc gcggatcatc ttcgtgaaca aaatggatcg cgagcgggcg       420
     gacttcgcca agaccgtcgc agacatccag aacaacttcg gcaagtcgtg cgtgcccttg       480
     cagattccca tcgggagcgc ggaaagcttc aaaggcgtgg tcgatgtgct caaccggaag       540
     gcctgcctgt acggacatgg ggacagcggc aagttcgagg tcaaggaaat gcccgccgat       600
     ctggccgatc aggtggcgca ctaccatgaa gaattggtcg aacgggtcgc cgaatccaat       660
     gacgagctgt tggagaaata tctggaatcc ggagaactgt ctcccgagga agtgaagaac       720
     gcgcttcgcg gcgccgtgac ttcggggact ctggtcccca ttgcatgcgg ttcgggggtt       780
     gccaacatcg gcattcacgg cctgatggac ctcatcgcgg attgtctgcc gtccccgctg       840
     gaccgcggac cgcggaccgg caaaggggcc cgtggagccg aggccgatcg cgagccggat       900
     ccggctgcgc cgttcagcgc actggtgatc aagaccatca gcgatcctta cgccgggcgc       960
     ctgtcggtga tgcgcgtctt ctcggggagc ttgtcgccgg attcgactgt tttcaactct      1020
     accaaggaaa ccaaggaaag attcggccag ttgctccggt tgaagggcaa gaaccaggaa      1080
     cccatccagg gttgcggtcc cggcgacgtc gtggcggtgg ccaagctcaa ggagacgacc      1140
     acccaggaca ccctgtgttc cgaaaaggac gtcatcagct tccctccggt ggagctcccg      1200
     cccgccattt attcgctggc tgtcgagccc aagagcaagg gtgacgagga gaagattttt      1260
     tcctcccttt cccgtctcat ggaagaagat cttacgctca agctcgaaag gaatgaggaa      1320
     accaaggaga tgatcctgtc cgggatgggg gaaatccata tcgaggccac ggttgacaag      1380
     ctgaagcgca aattcggcgt ggaggtcaat ctgcgcatcc cgaaggtgac gtacaaggaa      1440
     acgatcaagg ggaaagcccg cgtccaggga aaatacaaga agcagtccgg aggccgcggc      1500
     cagtacggag actgctggat cgagatggag cctctgccca ggggcgaagg cttccagttt      1560
     tatgacaaga tcgtaggcgg ggtgatcccg agacagtaca tcccggcagt ggaaaaaggc      1620
     atcgccgaag ccttggtgga gggtgctctg gcgggctatc ctgtggtcga tttcaaggtc      1680
     gatctggtgg acggctcttt ccaccccgtg gactcttccg aaatggcgtt caaaatcgcg      1740
     gggtcgatgg cgttcaagaa agccatgatg gaagccaagc cgacgctgct cgagccgatt      1800
     gtgttgatgg aaatcacggt tcctgacgat tgtatgggag atatcatagg cgacctcaat      1860
     tccaggcgcg ggcgagtgct tggaatggag agcaagggga aaaagcagat cgtccgcgcg      1920
     aacgtgccgc ttgccgaagt cctgaaatac gctcccgatt tgcgatccat gacggccggc      1980
     agaggtatgt tcacgatgaa gttttctcac tatgaggagg taccgggcca gttgcaggag      2040
     aagatcgtcg aggcggccaa ggcggaagaa aagtag                                2076
//

If you have problems or comments...

PBIL Back to PBIL home page