(data stored in ACNUC7421 zone)

EMBL: CP000478.PE69

CP000478.PE69        Location/Qualifiers
FT   CDS_pept        88040..88579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0070"
FT                   /product="molybdopterin adenylyltransferase"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain; PFAM:
FT                   molybdopterin binding domain; KEGG: sat:SYN_02931
FT                   hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15773"
FT                   /db_xref="GOA:A0LEC1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC1"
FT                   /protein_id="ABK15773.1"
FT                   /translation="MESRTTKQAKREFLRTVAIITVSDRGARGEREDASGQALHDLLTR
FT                   HGFDVCYQTIVPDEAEVISQAIRECAVVKRVALVLTTGGTGVSPRDVTPEATRAVIERL
FT                   VPGMAEAMRAANLLKTPHAMLSRAVVGIRGATLVINLPGSPTGAVENLSVLLGALPHAL
FT                   DKIQGDMSDCARPAGG"
     atggaaagcc ggacgacaaa acaggcgaaa cgggaattcc tccgcacggt cgccattatc        60
     accgtcagtg accgtggagc gcgcggcgag cgcgaagacg cttcgggaca ggcactgcat       120
     gacctcctga ccaggcatgg attcgacgtc tgctaccaga ccatcgtacc ggatgaagcg       180
     gaggtcattt cccaggcgat cagggaatgc gccgttgtga agagagtcgc tctggtgctc       240
     accacgggcg gcacaggggt atcgccgcga gacgtaacgc cggaggcgac tcgcgcggtg       300
     atcgaacgcc tggtcccggg catggcggaa gctatgcgcg ccgcaaacct gttgaagacc       360
     cctcatgcca tgctctcgcg ggccgtcgtc ggcattcgcg gtgccacgct cgtcatcaac       420
     ctgcccggca gcccgaccgg cgccgttgaa aatctaagcg tgctgctggg agcgttgccg       480
     cacgcattgg acaagatcca gggcgacatg tcggattgcg ccaggccggc cgggggctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page