(data stored in ACNUC7421 zone)

EMBL: CP000478.PE72

CP000478.PE72        Location/Qualifiers
FT   CDS_pept        complement(89747..90532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pca:Pcar_1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15776"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC4"
FT                   /protein_id="ABK15776.1"
FT                   /translation="MKTSRFHAVLLGLIMLCCLSCGKPKPPEVLPRPVSFDENLGKLEA
FT                   RAAHWRSYQAKLRIRLEGAKGKMRFQAIVLAVLPDQLRLEAFNLVGQTVALFTMNNGKP
FT                   ALSIPSEKMIFTAERPETLIEYFFGMPLPAGVFAYDLAAVVPPEQLDKLSPRREAPGWK
FT                   ADFSPEGSDASFLWEFEDNPPALKSLAARDGLWDRRITYDPAVELEPQNAPRKLRLESA
FT                   QWRMEITVEQIMPTSGFDASVFVPPVQEGVRTVDLDSIK"
     atgaagacct cccgctttca tgccgtgctg ctgggtctga tcatgctctg ctgcctctcg        60
     tgcgggaaac ccaaaccgcc ggaggtgctg ccccggcccg tttccttcga cgaaaacctc       120
     ggcaagcttg aagcgagggc cgcccactgg cgaagttatc aggcaaaact gcgtatcagg       180
     ctcgagggcg ccaagggcaa gatgcgtttt caggccatcg ttctggccgt tctgccggat       240
     cagttgcgcc tggaagcctt caacctggtc gggcagaccg ttgcgctgtt caccatgaac       300
     aacggcaagc ctgccctgtc cattccttcc gaaaagatga tcttcacggc cgagcggccc       360
     gaaacgctca tcgagtactt cttcggcatg cctttgcccg ccggggtctt cgcatacgac       420
     cttgccgcgg tcgtgcctcc ggaacagctc gacaagctca gtccacgccg ggaagcaccg       480
     ggctggaagg cggatttttc tcccgaggga agtgacgcgt cctttctctg ggagttcgag       540
     gacaatcctc ccgccctgaa atctcttgct gcaagagacg ggttgtggga ccgtcgcatc       600
     acctacgatc ccgcagtcga actggaaccg cagaatgcac ctcggaaact ccgactcgaa       660
     tcggcgcaat ggcggatgga aataaccgtc gaacagatca tgcccacttc cggcttcgat       720
     gcgtcggtct ttgtcccgcc cgttcaagag ggcgtccgta ccgtcgacct ggattcgatc       780
     aaatga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page