(data stored in ACNUC7421 zone)

EMBL: CP000478.PE73

CP000478.PE73        Location/Qualifiers
FT   CDS_pept        complement(90604..92307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0074"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sat:SYN_00192
FT                   tetratricopeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15777"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC5"
FT                   /protein_id="ABK15777.1"
FT                   /translation="MILRYLLIIAVLSVCSCTQLKPYAATSSTPKAPAARSESGSRADL
FT                   YFEYLLAQYYVSVKEIDKAIEAYHEALKKDPRSPMLLTELAALLIRQGKIEQALKLTED
FT                   ATSFDRTYEPAYMLLGQLYAGIGQNARAIDAYSRAIEINPSNEDAHLLLGALYAQEKKY
FT                   DEAMEAFDHLKALLPDNPVALYYKARVFLDMKLYKQAEKIYLDVLAIEPAFENASLDLA
FT                   YVYEVTERLKDAEQTYLQILSANPANVNARTRLGNLYMRQDRPAEALRHFSHLLKLNRK
FT                   DVESRLKVGIIHLQQKDYEEAIKDFTYLLKDEPQYDQALYYLASTYAEKQDFEQAIRNF
FT                   RLIARSSPLWPMAQTRLALIFSKQKDFQNGAAVLKEAIDAQPEVADLYLYLGIIYEEAK
FT                   QYEDGVAAVDRGLVKTPRDTDLLFRKGVILDKMSRRDDAIAVMKRILEIEPQNANALNY
FT                   IGYTYAEMGINLNEARQMIKAALATAPDDGYIMDSLAWVYYKLGQHKKALETILEALKR
FT                   VPQDPVIHEHLGDIYLSLGKKNEAIEAYEKALEYSHTEPEKIREKLDRLK"
     atgattctgc gataccttct catcattgca gtgctttccg tgtgcagttg cacccagctt        60
     aaaccgtacg cggcgacatc ttccaccccc aaagccccgg cagcccgctc cgagtcgggc       120
     tcacgcgccg acttgtactt cgagtacctg ctcgcccaat attatgtcag cgtgaaagaa       180
     atcgacaagg ccattgaagc ataccacgaa gccctgaaaa aggatccccg atcgccgatg       240
     ctgctcaccg agttggccgc tctcttgatc cggcagggca agatcgaaca ggccctcaag       300
     ctcaccgaag acgccacgag ctttgaccgc acctacgagc ccgcctacat gctcctcgga       360
     cagctgtatg ccggaatcgg gcagaatgcc agggccatcg atgcatatag ccgggccatc       420
     gagatcaatc cttccaacga ggatgcgcac ctccttctgg gcgcgctcta cgcccaggag       480
     aagaaatacg atgaggcgat ggaggcattc gaccacctca aggccctgct cccggacaac       540
     cctgtggcac tgtactacaa ggcacgggtt ttcctggaca tgaaacttta caaacaggcc       600
     gaaaagatct acctcgacgt tcttgcgatc gaacccgcat ttgaaaacgc ctctctcgac       660
     ctggcatacg tttacgaggt gaccgaacgg ctgaaggacg ccgagcagac ctatctgcag       720
     atcctgtcgg cgaatccggc caatgtaaac gcccgcacgc ggctgggcaa cctttacatg       780
     cgccaggaca ggcccgcgga ggccttacgg catttctccc atcttctgaa gctcaaccgc       840
     aaggatgtcg agagccgttt gaaagtgggc atcatccacc ttcaacagaa ggattacgag       900
     gaggccatca aggatttcac ctacctgttg aaggacgagc cgcagtacga ccaggctttg       960
     tactacctgg ccagcaccta tgcggaaaaa caggacttcg agcaggccat ccgcaacttc      1020
     cggctgatcg cacggagcag cccgctctgg cccatggccc agacccgcct cgccttgatt      1080
     ttctccaagc agaaggactt ccagaacggt gcggcggtcc tcaaggaggc gatcgacgcc      1140
     caaccggaag tggccgatct gtatctctat ctcggcatca tctatgaaga agcgaaacaa      1200
     tacgaggatg gcgtcgcggc ggtggacagg ggtctggtca agactccgcg agacaccgat      1260
     ctcctgttcc gaaaaggggt cattctcgac aagatgtccc gaagggatga cgccatcgcc      1320
     gtgatgaaac ggatcctcga gatcgagcct cagaacgcca atgccttgaa ctacatcggg      1380
     tacacgtatg cggagatggg aatcaacctc aacgaagccc gccagatgat caaggcggcc      1440
     ctggccaccg ctcccgatga tggttacatc atggacagcc tcgcctgggt ctactacaag      1500
     ctggggcaac acaagaaggc tttggagacc attctggagg cattgaagcg cgttccgcag      1560
     gaccccgtca tccacgagca tctcggggac atttacttga gtctcggaaa gaagaacgaa      1620
     gccatcgagg cctatgagaa agcgctggag tacagccaca cggagcccga gaagatccgg      1680
     gagaagctgg accggctcaa gtag                                             1704
//

If you have problems or comments...

PBIL Back to PBIL home page