(data stored in ACNUC7421 zone)

EMBL: CP000478.PE74

CP000478.PE74        Location/Qualifiers
FT   CDS_pept        92497..93741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0075"
FT                   /product="protein of unknown function DUF52"
FT                   /note="PFAM: protein of unknown function DUF52; KEGG:
FT                   aae:aq_1336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15778"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEC6"
FT                   /protein_id="ABK15778.1"
FT                   /translation="MTMEHPKLRYGLEALPMQHEGQNMILLRDRMGHSSDSLLLSPVVA
FT                   ELVIRMDGTNSFRDLQALFLRMTGEMLYTETLDEIVQKLDQNLFLENARFIDHVARQVA
FT                   RYRDDPVRRMRHAGQSYPSDAELLNRRLEGFFSAEDGGPGLPGAARDNRPVLGLVAPHI
FT                   DIQAGGRCFAHAYKAAADSVSPRTWIVLGTGHELVSNYFALTAKDFETPLGLVGHDEEC
FT                   CAHLVNSAKRDILAGEYNHVREHTVEFQAVFLAYVQPGAKIVPLLCSFSHEDLETDGEY
FT                   IDHFAGLLRDLVLTRSVGILASVDLAHIGPRYGDRFQPTDSTVKDHMASDRGLVESLRE
FT                   CDAEAFIRQIRLEGNRRKICGVAPLYVLAQALSGLAQGRLLDHAHVRVDPYGSFVTFAS
FT                   MIFHGTQASPGSDSE"
     atgacaatgg aacaccccaa gctgcgttac ggactggaag ctttgcccat gcaacacgaa        60
     ggacagaaca tgatccttct cagggaccga atgggccaca gctcggactc cctgctgctt       120
     tctcccgttg ttgcggaact ggtgatccgc atggacggaa cgaattcctt tcgggatctg       180
     caggcccttt tcctgcgcat gaccggtgaa atgctgtaca cggagacgct cgacgaaatc       240
     gtgcagaaac tggaccagaa cctcttcctc gagaatgcga gattcatcga tcatgtggca       300
     aggcaggtcg cgcgctaccg ggacgatccc gtgagaagga tgcggcacgc cgggcagagc       360
     tacccgagcg atgcggagct gttgaatcgg cggctggagg ggtttttctc ggcggaagac       420
     ggaggccccg ggcttccggg ggcggcgcgc gacaaccggc ccgtgctggg actggtcgct       480
     ccacatatcg acattcaggc tggcggccgg tgctttgcgc atgcctacaa ggccgccgcg       540
     gattccgttt cgccgcggac ctggatcgtg ctcggcaccg ggcatgaact ggtatccaac       600
     tatttcgctc tgaccgccaa ggacttcgag acccccctgg ggctggtcgg tcatgacgaa       660
     gaatgctgcg cgcatctggt taattcggcg aagcgcgata tccttgccgg cgaatacaac       720
     cacgtacggg aacacacggt ggaattccag gctgtattcc tggcttatgt ccagccgggg       780
     gcgaagatcg tgcccctcct gtgctccttt tcgcacgagg acctggaaac ggacggggaa       840
     tacatcgatc atttcgccgg tctccttcgc gacctggtgc ttacccgttc cgtgggaatt       900
     ctggccagcg tcgacctggc ccacatcggt ccgcgctacg gggaccgctt ccagccgacc       960
     gacagcacgg tgaaggacca catggcctcg gaccgcgggc ttgtggaaag cctgcgcgaa      1020
     tgcgacgccg aagctttcat ccgccagatc cgcctcgaag gaaaccggcg gaaaatctgc      1080
     ggggtcgcgc ccctgtatgt gctggcccaa gcgctctccg gtctcgcgca gggacggctc      1140
     ctggatcacg cgcacgtcag ggtcgatccc tatgggtctt tcgtcacctt tgcgagcatg      1200
     attttccatg ggacgcaggc gagccctggg tcggattcgg agtga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page