(data stored in ACNUC7421 zone)

EMBL: CP000478.PE8

CP000478.PE8         Location/Qualifiers
FT   CDS_pept        complement(9364..12606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0008"
FT                   /product="carbamoyl-phosphate synthase large subunit"
FT                   /note="TIGRFAM: carbamoyl-phosphate synthase, large
FT                   subunit; PFAM: phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein,
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   Carbamoyl-phosphate synthase L chain, ATP-binding;
FT                   Carbamoyl-phosphate synthetase large chain,
FT                   oligomerisation; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; MGS domain protein; KEGG: sat:SYN_01625
FT                   carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15712"
FT                   /db_xref="GOA:A0LE60"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0LE60"
FT                   /protein_id="ABK15712.1"
FT                   /translation="MPKRTDIRKILIIGSGPIIISQACEFDYSGTQACKALREEGYEIV
FT                   LINSNPATIMTDPETADRTYIEPITPEAVAKVIERERPDALLPTLGGQTALNVAVRVAE
FT                   TGVLERFGVALIGASVEVIKKAEDRELFRDAMKRIGLRVPASGIARSMSEVESIAREIG
FT                   FPIIVRPSFTLGGTGGGVAYNREELKELAQSGLDASFIHTVMLEESVLGWKEFELEVMR
FT                   DCMDNVVIICSIENMDAMGVHTGDSITVAPAQTLTDREYQLLRDASIAILREIGVETGG
FT                   SNVQFAINPADGEMVVIEMNPRVSRSSALASKATGFPIAKIAAKLAVGYSLDEIANDIT
FT                   RETRASFEPTIDYCVVKVPRFTFEKFPRTEDFLSTSMKSVGETMAIGRTFKEALHKAVR
FT                   SLEIGRFGFVDPPANADREYMERLRQKLRRPNSMRLFQIGEALKLGMPIEELHALTFID
FT                   PWFLHHIRQVLLLEDEIRGDADRSGFLDDPERVRYAKSWGFSDVRLAQLSGSDEETVRQ
FT                   LRIKHGIKPVYKLVDTCAAEFEAYTPYYYSTYETEDEARPTGRPKVVILGGGPNRIGQG
FT                   IEFDYCCVHASFSLREEDHESIMVNSNPETVSTDYDTSDKLYFEPLTREDVLHILDTEK
FT                   PKGVIVQFGGQTPLNLSVPLEKAGARILGTSPDAIDRAEDRKRFQKLLQKLGLKQPRNA
FT                   TAFTLREAAEAAGRIGYPVVVRPSYVLGGRAMEIVFDAAMLESFMKTAVHVSPGHPILI
FT                   DQFLEDAVEIDVDAISDGTVTVVGGIMEHIEQAGIHSGDSACVLPPMSISRSIQEEIRR
FT                   QTRLLAKELGVVGLMNIQFALQNGEIFILEVNPRASRTIPFVSKAIGFPLAKLATRVML
FT                   GKSLKELGFDTEVEPEHISVKEAVFPFSRFPNVDVLLGPEMKSTGEVMGIGSTFGIAFA
FT                   KAQAAVGYELPTSGTVFISVHDADKPKVLSVARKFGEMGFQLIATAGTADFLNGNGIRT
FT                   RPVFKLKEGRPHVVDRIKNGEVQLVVNTSMGKKTTSDSYEIRRTTLIYNIPYATTIAGA
FT                   KAMAEAVSELQRGDWDVRTLQEYHHRERSRRQ"
     atgcccaaga gaaccgacat acgaaagata ttgatcatcg gatccggccc catcatcatc        60
     agccaggcgt gcgagttcga ctactccggg acccaggcct gcaaggcatt gcgcgaggaa       120
     gggtacgaga ttgtcctgat caacagcaac cccgcaacaa taatgaccga tccggaaacg       180
     gccgaccgca cctatatcga gccgatcacg cccgaagcgg tggcgaaggt gatcgagcgg       240
     gagcgtcccg acgcgctgct gcccaccctg ggcgggcaga cggccctgaa cgtggcggtg       300
     cgcgtggccg aaacgggtgt gctcgaacgt ttcggcgtgg ctctcatcgg agcgagtgtt       360
     gaagtcatca agaaagccga agaccgggaa ttgttccgcg atgccatgaa gcggatcggg       420
     ctgcgcgttc cggccagcgg cattgcgcgt tccatgtcgg aagtggaatc cattgcccgg       480
     gagatcggtt tcccgatcat cgtgcggcct tctttcacgc tgggcggcac ggggggcggc       540
     gtggcctaca accgggaaga attgaaggaa ctggcccaga gcgggctgga tgccagtttc       600
     attcacaccg tcatgctcga ggagtcggtg ctcggctgga aggaattcga gctcgaggtc       660
     atgcgcgact gcatggacaa tgtggtcatc atctgctcca tcgagaacat ggacgccatg       720
     ggcgtccata cgggggattc gatcacggtg gctccggccc agaccctgac cgaccgggaa       780
     tatcaattgc tgagggacgc ctcgattgcg attctgcggg aaatcggcgt ggagacgggg       840
     gggtccaacg tccagttcgc catcaacccc gccgacgggg agatggtcgt catagagatg       900
     aacccccggg tctcccggtc atcggccctc gcatccaagg cgacggggtt tcccattgcc       960
     aagatcgccg ccaagctggc cgtggggtat tccctggacg agatcgccaa cgacatcacc      1020
     cgggagacca gggcttcgtt cgagcccacc atcgattact gcgtggtgaa agtgccccgg      1080
     ttcacgtttg aaaagtttcc caggacggag gatttccttt ccacttcgat gaagtccgtg      1140
     ggcgagacga tggccatcgg cagaaccttc aaggaagcgc tccacaaagc cgtccggtcc      1200
     ctggagatcg gtcgcttcgg attcgtcgac ccgccggcga acgcggaccg cgaatacatg      1260
     gagcgtctga ggcagaagct tcgccgaccc aattccatgc gcctttttca gatcggggaa      1320
     gccctgaagc tgggcatgcc catcgaagag ctgcacgcgc tgactttcat cgacccctgg      1380
     tttctccacc acatccggca ggtgctgctg ctcgaggacg aaatccgggg cgacgcggac      1440
     cgctccggtt tcctggacga tcccgagcgg gttcgttacg cgaagtcgtg gggcttttcc      1500
     gacgtgcggc tggcccaatt gagcggctcg gacgaggaaa ccgtccgtca gcttcggatc      1560
     aaacacggca taaagccggt ctacaagctg gtggacacct gcgcggcgga attcgaagcc      1620
     tacactccgt actattattc gacctacgaa accgaagacg aagcccggcc taccgggcgt      1680
     ccgaaggtcg tgatcctcgg gggcggaccc aatcggatcg gacagggcat cgaattcgac      1740
     tactgttgtg tccacgcttc tttttccctg cgcgaggagg accatgagtc catcatggtc      1800
     aattccaacc cggaaaccgt ctccaccgac tacgacactt cggacaagct ttatttcgaa      1860
     ccgctgaccc gcgaggacgt gctccacatc ctcgataccg agaagcccaa aggggtgatc      1920
     gtgcagttcg gagggcagac ccccctgaac ttgtcggtcc cccttgaaaa ggccggggcc      1980
     aggattctcg gtacatcccc cgacgccatc gatcgcgccg aagaccgcaa gcggttccag      2040
     aaactgttgc agaaactggg tctcaagcaa ccccgcaacg ccaccgcgtt caccttgcgg      2100
     gaggccgccg aggcggccgg gcggatcggc tatccggtgg tggtgaggcc gtcttacgta      2160
     ttgggcggca gggccatgga aatcgtcttc gacgcggcaa tgctggagag tttcatgaag      2220
     accgcggtgc acgtatcacc ggggcacccc atcctgatcg accagttcct cgaggatgcc      2280
     gtcgagatcg atgtggacgc catcagcgac ggcacggtga ccgtggtggg cggaatcatg      2340
     gagcatatcg agcaggccgg aatccattcg ggagacagtg cctgcgttct gccgcccatg      2400
     agcatctccc gaagcatcca ggaagagatc aggcggcaga ccaggctgct ggcgaaggaa      2460
     ctgggggtcg tcgggctgat gaacatccag ttcgctctgc agaacgggga gattttcatc      2520
     ctcgaagtca acccgcgcgc ctcgcggacc attccattcg tcagcaaagc cattggattt      2580
     cccttggcaa agctggccac cagggttatg ctgggaaagt cattgaaaga actgggattt      2640
     gacacggaag tggaacccga acacatctcc gtcaaggaag cggtattccc cttttcgcga      2700
     ttcccgaacg tcgacgttct gctcggcccc gaaatgaaat cgaccggcga ggtgatggga      2760
     atcgggagca ctttcggcat tgccttcgcc aaagcacagg cggcggtggg atacgagctt      2820
     ccgacatcgg gcaccgtgtt tatcagcgtg cacgatgcgg acaagccgaa agtgctgtcc      2880
     gtggcgcgca aattcggcga aatgggattc cagctgatcg ccaccgcggg aacggccgat      2940
     ttcctgaacg ggaacgggat acgaaccaga ccggtgttca agctaaaaga gggacggcct      3000
     cacgtcgtgg atcgcatcaa gaacggcgaa gtccagctgg tggtcaacac cagcatgggc      3060
     aagaaaacca cttcggattc gtacgaaata agacgaacga cactcatcta caacattccc      3120
     tacgccacca cgatcgccgg cgcaaaggcg atggcggaag cggtgagcga gctgcagcgc      3180
     ggcgactggg atgtgagaac gcttcaggag tatcaccacc gggagcggtc gagaaggcag      3240
     tga                                                                    3243
//

If you have problems or comments...

PBIL Back to PBIL home page