(data stored in ACNUC7421 zone)

EMBL: CP000478.PE86

CP000478.PE86        Location/Qualifiers
FT   CDS_pept        106093..107361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hma:rrnAC0622 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15790"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:A0LED8"
FT                   /protein_id="ABK15790.1"
FT                   /translation="MKAREPDTIAGIPLTPESGLILRCVRHYSGRDERTRIARQLQGRL
FT                   DWDALLRLAEAHKILPILHAVLKESHWREVPESVLETMKRKHAANFAGNLLLSYELIRI
FT                   LEALGSRGIRCLVFKGPTLAVAAYGSIAMRRFQDLDLLVRRNDFLKTKDLLREIGYQPA
FT                   LRLPEAYEKHFYLTRSEHHFVRNDGKATVDLHWGLSPPCFSFFQDLDRLWPRSVTVAIE
FT                   GATVRAPGMEDLLLFLCRHGAKHRWEGLSLISDVAVLIAAHRAMDWPGVLARAKRTNST
FT                   VMLALGLRLAAELAGAEVPENIGDWMRADRKGEVLAGKVIRSLFSSEERPTVDVADRLN
FT                   LFHMRTMSRFTDRLHEIVLNLFTPTSIELSLIRLPARLYFLYYPCRLLRLAVRSVLNKA
FT                   LRTPRRQTPDRTGARRTSGSDKP"
     ttgaaagccc gggaacccga cacaattgcc ggaattccat tgacccctga atccgggttg        60
     atcctgagat gcgtgcgcca ctactccggc agggacgaaa ggacgcgaat cgcgcggcag       120
     cttcagggcc gcctcgactg ggacgccctc ctccgcctgg cggaggccca caaaatcctg       180
     ccgatcctgc acgcggtgct caaggaatcc cattggcgcg aagtgccgga atccgtgctg       240
     gagacgatga agcgcaagca tgcagccaat ttcgccggaa atctcctgct gagctatgaa       300
     ctgatcagaa tactcgaagc cttgggaagc cgcggcatcc gttgcctggt gttcaagggc       360
     cccactttgg ccgtggccgc ctacggaagc atcgccatgc gccggttcca ggatctggac       420
     cttctggttc gcaggaacga tttcctcaag acaaaggacc tcttgcggga aatcggctat       480
     caacccgcgc tgaggctccc ggaagcctac gaaaaacatt tctacctgac gcgctcggaa       540
     caccatttcg tccgcaatga cggcaaggcg acggtggatc tgcactgggg actgtcgccg       600
     ccgtgcttct ccttcttcca ggacctggat cggctctggc cccgtagcgt gacggtcgca       660
     atcgaaggcg caacggtcag ggctccgggt atggaagacc tgctcctgtt tctctgccgg       720
     cacggtgcga aacaccgctg ggaaggcctt tccctgattt ccgatgtcgc cgtgctgatt       780
     gcggcgcacc gcgcgatgga ctggcccggc gtcctggcgc gggcgaagcg gaccaacagc       840
     acggtgatgc tcgcgctcgg cctgagactg gcggctgaac tagcgggagc cgaagtaccg       900
     gaaaacatcg gggactggat gcgtgccgac cgcaaaggag aggtcctggc agggaaggta       960
     atccgttccc tgttcagctc cgaagaacgg ccgacggtgg atgttgccga ccggttgaac      1020
     ctcttccaca tgaggacaat gtcgagattc acggacagac tccatgaaat cgtcctcaat      1080
     ctgttcactc ccacatccat cgaattgtcc ctcatccgcc ttcccgcgag gttgtatttc      1140
     ctctactacc cctgccgctt gttgaggctg gcggtcagga gcgtgttgaa caaagcgctt      1200
     cgaacaccac ggcggcagac cccggatcgc acgggcgcga ggcgaacgtc ggggtcggac      1260
     aaaccctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page