(data stored in ACNUC7421 zone)

EMBL: CP000478.PE90

CP000478.PE90        Location/Qualifiers
FT   CDS_pept        111908..112576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0091"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: dvu:DVU3145
FT                   hydrogenase, b-type cytochrome subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15794"
FT                   /db_xref="GOA:A0LEE2"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE2"
FT                   /protein_id="ABK15794.1"
FT                   /translation="MTQTEMVNVYLYTRYERFWHWLQTTLIVLLLMTGFEINGLFRLFG
FT                   FKLATEIHEYAGLSWLIAFAFFVFWLFTTGEWRQYIPTTRKMLTVIRYYTYGIFRGEAH
FT                   PVPKRKDAKHNPLQRLVYLSLAAILLPIQMITGFLYWGYNSWPDWGLNWLSLEVVASIH
FT                   LAGAFGVLSFLIVHLYMITTGHTLFAHTRAMITGWEQVAEGTPIDDWERKDRGKSAECS
FT                   "
     atgacgcaga ctgagatggt caacgtctat ctttacaccc ggtacgaaag attctggcac        60
     tggctgcaga ccactctcat cgtgctgctg ctgatgacgg gattcgagat aaacggcctg       120
     ttccggcttt tcgggttcaa actggccacc gagatccacg agtacgccgg tctttcctgg       180
     ctcatcgctt ttgccttttt tgtcttctgg ctcttcacta cgggagaatg gcgccagtac       240
     atccccacca ccaggaagat gctgaccgtt atccgctatt acacttacgg gatcttccgc       300
     ggggaagccc accccgttcc gaaacgcaag gacgccaaac acaacccttt gcagcgattg       360
     gtgtaccttt ccctggcggc gattctcctc cccatccaga tgatcaccgg ctttctctac       420
     tggggttaca attcctggcc ggactgggga ctgaattggc tgtccctgga ggtggttgcg       480
     agcatccatc tggccggggc cttcggcgtt ctctcttttc tgattgtgca cctgtacatg       540
     atcactaccg gccacacgct tttcgcccac accagagcca tgatcaccgg ttgggaacag       600
     gtggcggagg gtactccgat cgacgattgg gagcgcaagg atcgcgggaa atcggcggag       660
     tgttcctga                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page