(data stored in ACNUC7421 zone)

EMBL: CP000478.PE92

CP000478.PE92        Location/Qualifiers
FT   CDS_pept        complement(114050..114370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0093"
FT                   /product="Rhodanese domain protein"
FT                   /note="SMART: Rhodanese domain protein; KEGG: tbd:Tbd_2657
FT                   rhodanese-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15796"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE4"
FT                   /protein_id="ABK15796.1"
FT                   /translation="MKCSVDPEELKRALADAPDETVVIDVRRKTDFETDPRLIPGAQWK
FT                   DPEQVDDWSRELPRDKTVIVYCVRGGPVSRPVSAKPAENQVRVKYLEGGLAGWDLSAKE
FT                   DR"
     gtgaaatgct cggtggatcc ggaagaactg aagagagcgc ttgctgacgc gccggacgag        60
     acggtcgtca tcgacgtgcg tcgcaagacc gattttgaaa ccgacccgcg cctcattccc       120
     ggtgcccaat ggaaagatcc cgagcaggtg gatgactgga gcagggagct tcccagggac       180
     aagaccgtga ttgtgtattg cgtgcgcggc ggccccgtca gccggcctgt gtcggcgaag       240
     ccggcagaga accaggtccg agtgaagtat ttggagggag gtctggcggg ctgggatctt       300
     agcgccaaag aggatcgatg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page