(data stored in ACNUC7421 zone)

EMBL: CP000478.PE93

CP000478.PE93        Location/Qualifiers
FT   CDS_pept        complement(114367..115656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0094"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dvu:DVUA0096 major facilitator superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15797"
FT                   /db_xref="GOA:A0LEE5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE5"
FT                   /protein_id="ABK15797.1"
FT                   /translation="MDVEPATESKTMNPFSQLFGLCAVGFFARLSYALARSPVLPLFAL
FT                   YLGAAPEIIGWVVGISTVTGIFFKLPSGALSDVIGRRKTMLVGLVVFALTPFAYFWVKD
FT                   AALLLIVRFVHGFATAVYGPVAMAVVADVAGCRKGEMLSWFSSVTIAGSLLGAPLGGFL
FT                   LFTLARSGSPSLEHFHWVYLASGAFGCVALILGGKLLAGGDETVTQVGLKASLAQFGAG
FT                   IREVVSDRRVVLTSSMEGLQNMTMGALEAFLPIYAVKVAGLNEFQAGLLWGAQVLVTIV
FT                   SKPLMGRLSDRYGRKPAIVIGMLACAVAFAAIPLLTRFELLILASLLFGLGEAFVTSSS
FT                   AALVADLCQERHFGTAMGTFGTIFDVGHASGPILAGVLIASWGYLPAFSIMSAALVVAL
FT                   PVFILGVKVESRTSMVTSRVWRRRHRKGLP"
     ttggatgtcg aaccagcgac ggaatcaaag accatgaatc cattcagtca actgtttggg        60
     ctgtgtgcgg tgggtttctt cgcccggttg tcctatgccc tggccagaag tccggtgttg       120
     cccctcttcg ccctctatct gggggcagca ccagagatca ttggctgggt cgtgggcatt       180
     tccacggtga cggggatttt tttcaaactc ccctccggtg cgctgtcgga tgtcatcggc       240
     cgtcgaaaaa ccatgctggt gggcctggtc gtctttgccc tgaccccctt cgcctacttc       300
     tgggtaaaag atgccgcgct gctgctcatc gttcgttttg ttcacggatt cgccacggcc       360
     gtttacggcc ccgtggccat ggcggtggtg gccgacgtgg cggggtgccg caagggagag       420
     atgctctcct ggttctcgtc ggtcaccatc gccggtagcc tcctgggggc ccccctggga       480
     ggttttttgt tgttcaccct ggcgcgatcc ggcagccctt ccctggagca cttccactgg       540
     gtttacctgg caagcggggc gttcggatgt gtggctctga tactgggggg aaaactcctt       600
     gccggtggag atgaaaccgt gacccaagtg ggtctcaagg catcgctcgc acagttcgga       660
     gccgggattc gggaggtggt gagcgaccgc agagtggttc ttacctccag catggaaggg       720
     ctccagaaca tgaccatggg cgccctggag gccttccttc ccatctacgc ggtgaaagtg       780
     gccgggctca acgaattcca ggccggtctc ctgtgggggg cgcaagtgct cgtcaccatc       840
     gtgtccaaac ccttgatggg tcgcctctcg gaccgctacg ggcgcaaacc ggccatcgtc       900
     atcggcatgt tggcttgtgc cgtggccttt gccgcaatcc cccttcttac acggtttgag       960
     cttttgattt tggcttcact cctgttcggt ctgggggaag ccttcgtgac ctcgtcttcg      1020
     gcggctctgg ttgccgacct ttgccaggaa cggcattttg gcacggccat ggggaccttc      1080
     gggaccatct tcgatgtggg ccatgcatcg ggtcccattc tggcgggggt gctcatcgcc      1140
     tcctggggct accttccggc cttctccatc atgagcgccg cgctggttgt tgccctcccg      1200
     gtctttatcc tgggggtaaa ggtggaatct cgaacatcca tggtcacttc gcgcgtttgg      1260
     cgtcgtcgtc accggaaagg attgccgtga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page