(data stored in ACNUC7421 zone)

EMBL: CP000478.PE96

CP000478.PE96        Location/Qualifiers
FT   CDS_pept        116913..117332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sfum_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_0357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sfum_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ABK15800"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="UniProtKB/TrEMBL:A0LEE8"
FT                   /protein_id="ABK15800.1"
FT                   /translation="MKWITWSGVGVDRIACAWLIRRMVDRDAEFIFIPRGSDWKQLDGI
FT                   AFDIPGANLSHRRGRCTFCTVLKEYSISDRTMDQICAIVDAADSVNDLLPPPEAAGIDV
FT                   ICRGLIKVLKHDVKALEVGAILFEALYVQLAEEFQ"
     atgaaatgga tcacctggtc gggtgtgggc gtggatcgca tcgcctgcgc ctggctcatt        60
     cgccgcatgg tggatcgcga tgcggagttc atcttcatcc cacggggcag tgactggaag       120
     cagttggacg gcattgcctt cgatattccc ggcgccaacc tcagtcaccg gcgagggcga       180
     tgcaccttct gcacggtttt gaaggagtat tcgatcagtg accgaaccat ggatcagatt       240
     tgtgccattg tggatgcggc cgactcagtc aacgatctat tgccgccgcc cgaagcggcc       300
     gggatcgatg tgatttgccg cggcctgatc aaagtcctga agcatgatgt caaggccctg       360
     gaagtgggcg ccattttgtt tgaggcactc tatgtccaat tggccgaaga attccaatga       420
//

If you have problems or comments...

PBIL Back to PBIL home page