(data stored in ACNUC7421 zone)

EMBL: CP000489.PE101

CP000489.PE101       Location/Qualifiers
FT   CDS_pept        complement(94406..94681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68218"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY74"
FT                   /protein_id="ABL68218.1"
FT                   /translation="MRSDSYGMLKASSVRTVTDPLRGTMQSLAVPPDLSEDLCLLTLSR
FT                   ELDALTYRRRDVYPRRRFDPTRPPYLARQLPYADHKKTRFRSRVSR"
     ttgcggtctg attcgtacgg gatgctcaaa gcctcgtcgg tgcgaaccgt gacagatccg        60
     cttcgcggga caatgcagtc acttgccgtc ccaccagatc tgtcagaaga tctttgcctg       120
     cttactctct ctagggaact cgatgcgctt acatatcgga gacgcgatgt ttatccccgg       180
     aggagattcg atcccacgcg gccaccttat ttggcccgtc aactgcccta tgccgatcat       240
     aaaaaaactc gtttcagatc aagagtatcg cggtga                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page