(data stored in ACNUC7421 zone)

EMBL: CP000489.PE103

CP000489.PE103       Location/Qualifiers
FT   CDS_pept        95326..95817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0103"
FT                   /product="protein of unknown function DUF132"
FT                   /note="KEGG: rru:Rru_A1415 protein of unknown function
FT                   DUF132"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68220"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY76"
FT                   /protein_id="ABL68220.1"
FT                   /translation="MSLSRERSQTGILTSYEMSVYGLSMRLVLDTNVIVAAFRSRNGAS
FT                   NLLLRAVDRGVLTPLCSTALFLEYEAVLSREETRKATGHSLEDVTGVMSALAAVSEGVD
FT                   ISFRTRPMLSDVADEMVLEAALNGQAEAIVTHNVKDFRPALTLGVTIATPGEIVRRLNT
FT                   "
     atgagcctat cgcgagagag atcgcagacc ggaatattga catcatatga gatgtcagta        60
     tatggtttga gcatgaggct ggttctggac accaacgtga tcgtggcggc gttccgcagt       120
     cgcaacggtg caagcaatct gctgttgcgg gcagttgacc ggggcgtgct gacgccgctt       180
     tgctcgacgg cgctgtttct cgaatacgag gcggtgttga gccgggagga aacccggaag       240
     gcgacaggtc atagtctgga ggacgtcact ggggtgatga gcgcgctcgc agccgtgtcc       300
     gagggcgtcg atatttcgtt tcggacgcga cccatgctgt ccgatgtcgc cgatgagatg       360
     gtgcttgagg ccgcgttgaa tggacaagcc gaggccatcg tgacgcataa tgtcaaggac       420
     ttccgcccgg cgctcacgct gggcgtcacg atcgcaacgc cgggagagat cgtcaggagg       480
     ttgaacacat ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page