(data stored in ACNUC7421 zone)

EMBL: CP000489.PE104

CP000489.PE104       Location/Qualifiers
FT   CDS_pept        95814..96074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0104"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sus:Acid_1920 conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68221"
FT                   /db_xref="GOA:A1AY77"
FT                   /db_xref="InterPro:IPR008651"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY77"
FT                   /protein_id="ABL68221.1"
FT                   /translation="MTQAQRYKYPLQLPQSLKETAARLAQEDGVSLNQWIVSAVAQKIG
FT                   AVETAADFLKARAGTAKRGDLTAFLDRAPDVPPMPKDAIKD"
     atgacgcagg cccaacgcta caaatacccg ctgcaactgc cgcagtcgct caaggagacg        60
     gcggcacgtc tggcgcagga ggatggcgta tcgctcaatc agtggatcgt ctcggcggtt       120
     gcgcagaaga tcggcgcggt ggagaccgcc gccgatttcc tgaaagcgcg cgctggcacg       180
     gcgaagcgcg gcgatctgac ggcatttctg gatcgcgcac cggatgtgcc gccgatgccg       240
     aaagatgcca tcaaggattg a                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page