(data stored in ACNUC7421 zone)

EMBL: CP000489.PE106

CP000489.PE106       Location/Qualifiers
FT   CDS_pept        complement(97636..99429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0106"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nha:Nham_3864 recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68223"
FT                   /db_xref="GOA:A1AY79"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY79"
FT                   /protein_id="ABL68223.1"
FT                   /translation="MRVAIYARYSSDQQREASIADQFRMCRLRAEKEGWTVVEEYSDHA
FT                   ISGSSMIQRPGIQALILDSSRGRFDMVLAEALDRISRDQEDIAGIYKRMCYADIKMFTL
FT                   SEGEITQLHVGLKGTMNALFLKDLADKTRRGLRGRVEDGKSGGGNSYGYDVVKRFDGNG
FT                   EPIRGDRTINEAQAAVIRRIFADYDSGLSSRTIAMTLNREGVPGPMGREWGPSTIHGNR
FT                   ERGTGILNNELYVGRLVWNRLRYVKDPDTGRRVSRLNPESEWVTQDVPDLRIVDQALWD
FT                   AVKARQGELAFSTRSRPEGNPLNDRRRPKHLFAGLVKCGCCGGGYSMISKDLLGCSTAR
FT                   NKGTCDNRVNIRRDALEASVLNGLKKHLMEPELFREFCTEFTREVNRLRMERGADLEVA
FT                   RRDLDRTTRELDKAIDAILQGVPPLTLKDKITQLEARKAELTEKLANADEPPPLLHPNM
FT                   AALYAQRIAKLSENLQQEDSRAQAAEILRSLVEQVTLVPEDGELAIVLRGDLGAILRFA
FT                   AGRKNPDFLSEAEALDNLLAQSGGSRKPWRGQQKTSSAVALEVSQLSLVAGACGHWRHN
FT                   RCSPLFRLDGGDTENAHQLAA"
     atgagagtcg ccatctacgc ccgctattcc tccgaccagc agcgcgaggc gtcgatcgcc        60
     gaccagttcc gcatgtgtcg gctgcgcgcc gagaaggaag gctggacggt ggtcgaggaa       120
     tattccgacc atgccatctc cggctcgagc atgatccagc gccccggcat ccaggcgctg       180
     atcctggatt cgtcgcgcgg ccgcttcgac atggtgctgg ccgaggctct ggaccggatc       240
     agccgcgacc aagaggatat cgccggcatc tacaagcgca tgtgctatgc agacataaaa       300
     atgttcacct tgtccgaggg cgagatcacc cagctgcatg tcggactgaa gggcacgatg       360
     aatgccctgt tcctgaagga tctggccgac aagacgcgcc ggggattgcg cggccgggtc       420
     gaggacggca aatccggtgg cggcaattcc tacggctacg atgtggtgaa gcggttcgac       480
     ggcaatggcg agccgatccg cggcgaccgg acgatcaacg aggcgcaggc cgccgtgatc       540
     cgccgcatct tcgccgatta cgacagcggg ctctcgtcgc gcaccatcgc catgacgctg       600
     aaccgcgagg gcgtgcccgg tcccatgggc cgggaatggg ggccgtcgac catccatggc       660
     aaccgcgagc gcggcaccgg catcctgaac aacgagcttt atgtcggccg gctggtctgg       720
     aaccggctgc gctacgtcaa ggatcccgac accggtcgcc gggtctcacg gctgaacccg       780
     gaaagcgaat gggtcaccca ggatgtgccc gacctgcgca tcgtcgacca ggcgctctgg       840
     gacgcggtga aggcgcggca gggcgaactg gccttctcga cccgcagccg gccggaaggt       900
     aatccgctga acgaccggcg gcgcccgaag cacctcttcg ccggcctggt caaatgcggc       960
     tgctgcgggg gcggctattc gatgatctcg aaggatctcc tgggttgctc gacggcgcgg      1020
     aacaagggca cctgcgacaa ccgcgtcaac atccgccgcg atgcgctcga ggcctcggtc      1080
     ctgaacgggc tcaaaaaaca cctgatggag ccggagctgt tccgggagtt ctgcaccgag      1140
     ttcacccggg aggtgaaccg gctgcggatg gagcgcggcg ccgatctgga ggtcgcacgc      1200
     cgggacctgg atcgcacgac gcgggaactc gacaaggcca tcgacgccat cctgcagggc      1260
     gtcccgccgc tgacgctcaa ggacaagatc acacaactgg aggcgcggaa ggccgagttg      1320
     acggaaaagc ttgccaatgc cgacgagccc cctcccctgt tgcacccgaa catggcggcg      1380
     ctctatgccc aacgcatcgc caagctttcc gagaacctgc agcaagagga cagccgcgcc      1440
     caggcggcgg agatcctgcg ctcgctggtc gagcaggtga cgctggtgcc ggaggatggc      1500
     gaactggcca tcgtgctgcg cggcgatctc ggcgccatcc tgcgctttgc cgcgggccgc      1560
     aagaacccgg atttcctgtc ggaggccgag gcgctggaca acctgctggc gcaatcgggc      1620
     ggctcgcgga agccgtggcg cggacagcaa aaaacctcct cggcggttgc cttggaggtt      1680
     tcgcaattat cgttggttgc gggggcctgc ggccactggc gacataacag atgttcgccc      1740
     ctgttccggc tggacggcgg cgataccgag aatgcccatc aactcgccgc gtag            1794
//

If you have problems or comments...

PBIL Back to PBIL home page