(data stored in ACNUC7421 zone)

EMBL: CP000489.PE107

CP000489.PE107       Location/Qualifiers
FT   CDS_pept        99430..99915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0107"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68224"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY80"
FT                   /protein_id="ABL68224.1"
FT                   /translation="MRVSASVGMLVMPLALFGLDEIPCRPSGEHADQFGKAWVGGGQGR
FT                   SGLSGWFQDHPEPFRIRVPLPCHRPVPLPARQDPRQKNRGVGPGGITGRFGRIASDLGA
FT                   AQRKPALPRLLQGVLRGCILVGWRKNTGKSRDISSQVTPSAGFRSSRTEPCGRVESS"
     gtgcgggtct ccgcgtcagt cgggatgttg gttatgcccc tcgcgctctt cggcctcgac        60
     gaaatcccgt gccgcccgtc gggcgagcat gcggaccagt tcggcaaggc gtgggtcgga       120
     ggagggcagg ggcgcagcgg actttcgggc tggttccagg accacccgga gccgttccgc       180
     atccgtgtgc ctctgccgtg ccatcgcccc gttccgcttc ccgcgcggca ggatccacgc       240
     cagaagaatc gtggcgtagg accgggcgga atcacaggca ggttcgggcg catcgcatcg       300
     gacctcggcg cagcacagcg taaaccggcg ctgccgcgcc tgctgcaggg ggtgctgcgc       360
     ggctgcatcc tcgtagggtg gcgtaaaaat actggaaagt cgcgggatat ctcgtcgcag       420
     gtcacaccgt cggcggggtt ccgcagctca aggacggaac cttgcgggag ggttgaatca       480
     tcgtag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page