(data stored in ACNUC7421 zone)

EMBL: CP000489.PE115

CP000489.PE115       Location/Qualifiers
FT   CDS_pept        complement(107337..108014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0115"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: rpe:RPE_2282 YecA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68232"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY88"
FT                   /protein_id="ABL68232.1"
FT                   /translation="MGRSDRDLDHLHELLWALPQENHPMSLSELDGYVTGILSCPDLIP
FT                   PSEWLLHVWGETGDARFPDLATAEATISAVMAHYNAIASEIARSPWLEPIYEVDPNSDE
FT                   TLWEPWVDGFTRALRLRPEAWQAVLEQADEETRSALIFLMALQDINEGTSTFTDEEIDE
FT                   IDLDAPDLIPNCVAAILLVSRPGGVLEAGNLPHAPTRIKRPGRNDPCPCGSGRKYKQCC
FT                   GKS"
     atgggcagat cggatcggga cctcgatcac cttcacgaac tcctgtgggc cctgccccag        60
     gaaaaccatc cgatgagcct aagcgagctc gacggctatg tgaccggcat cctgtcatgt       120
     cccgatctca tcccgccctc cgaatggctc ctccatgtct ggggagaaac cggcgatgcc       180
     cggttccccg acctggcaac ggcagaagca acaatctcgg cggtgatggc gcattacaat       240
     gccattgcct cggagatcgc acgaagccca tggctcgaac cgatctacga ggtggacccg       300
     aacagcgacg aaacgctctg ggaaccctgg gtggatggct tcacccgcgc tttgcgcctg       360
     cgccccgagg cctggcaggc ggtgctcgaa caggcggatg aggaaacgcg ctcggccctg       420
     atcttcctga tggccctgca ggacatcaac gaagggacca gcaccttcac cgacgaagaa       480
     atcgacgaga tcgatctgga tgcccccgac ctgatcccaa attgcgtcgc ggcgatcctg       540
     ctcgtctcgc gcccgggggg cgttctggag gcaggcaatc tccctcacgc cccaacccgc       600
     atcaaacgtc cgggccggaa cgatccctgc ccctgcggct cgggacgcaa atacaagcaa       660
     tgctgcggca agagttga                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page