(data stored in ACNUC7421 zone)

EMBL: CP000489.PE116

CP000489.PE116       Location/Qualifiers
FT   CDS_pept        complement(108141..108776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0116"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: atc:AGR_L_286 chloramphenicol
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68233"
FT                   /db_xref="GOA:A1AY89"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY89"
FT                   /protein_id="ABL68233.1"
FT                   /translation="MDNYFESPFRGITLDQQVTNPNIVVGRYSYYSGYYHGHGFDDCAR
FT                   YLLPDEGADRLIIGSFCSIGSGAGFIMAGNQGHRNDWISSFPFYWMPEVPAFAGAANGY
FT                   QPVGDTVIGSDVWIGSEAVIMPGIRIGDGAVIGTRALVTRDVEPYAIVGGNPAKVIRKR
FT                   FDDRQIGLLLEMRWWDWSDEQLHAAIPLLTSGEVEGLHRYWLEKIRAA"
     atggacaatt atttcgaaag cccgttccgg ggcatcaccc tcgaccagca ggtcaccaat        60
     cctaacatcg tggtcggccg ctacagctat tattccggct attaccacgg ccacggcttc       120
     gacgattgcg cccgatacct gctgcccgac gagggcgcgg accggctgat catcggcagt       180
     ttctgctcga tcggctcggg cgcgggtttc atcatggcgg gcaatcaggg ccaccggaac       240
     gactggatca gtagcttccc cttctactgg atgcccgaag tgcccgcctt cgccggcgcc       300
     gcgaacggct atcagcctgt gggcgacacc gtgatcggca gcgatgtttg gatcggctcc       360
     gaggcggtca tcatgcccgg tatccggatc ggcgacggcg cggtgatcgg cacccgcgcg       420
     ctggtgacgc gcgacgtgga accctacgcc attgtcggcg gcaaccccgc gaaggtgatc       480
     cgcaagcgtt tcgacgaccg gcagataggg ctgctgctgg agatgcgctg gtgggactgg       540
     tccgacgaac agttgcacgc cgccataccc ttgctgacca gcggcgaggt cgaggggctg       600
     cacaggtatt ggctggaaaa gatccgggcc gcatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page