(data stored in ACNUC7421 zone)

EMBL: CP000489.PE117

CP000489.PE117       Location/Qualifiers
FT   CDS_pept        109037..109393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68234"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY90"
FT                   /protein_id="ABL68234.1"
FT                   /translation="MTEIAPQPRIKLSKLRDIGWSLWDPIGLLDPESRAGRWDDEANLS
FT                   FADEYDGYLIAAASQLRRGTPRDEVVAFLVDIETRHMAMRDSPSVRLRAEAVVEAILAD
FT                   ETIWTWPDAQGRFG"
     atgaccgaaa tcgcaccgca accccggatc aagctgtcga agctgcgcga tatcggctgg        60
     tcgctctggg atcccatcgg gctgctggac ccggaaagcc gggcgggcag gtgggacgac       120
     gaggccaacc tgtccttcgc ggacgaatat gacggctatc tgatcgcggc ggcctcgcaa       180
     ctgcgccggg gaacgccccg cgatgaggtg gtcgcattcc tggtcgatat cgagacccgg       240
     catatggcga tgcgcgacag cccgagtgtt cggctgaggg cggaagcggt cgttgaggcg       300
     atcctggctg acgagaccat ctggacatgg cccgatgcgc aggggcggtt cggttag          357
//

If you have problems or comments...

PBIL Back to PBIL home page