(data stored in ACNUC7421 zone)

EMBL: CP000489.PE119

CP000489.PE119       Location/Qualifiers
FT   CDS_pept        109994..110410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0119"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3831 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68236"
FT                   /db_xref="GOA:A1AY92"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY92"
FT                   /protein_id="ABL68236.1"
FT                   /translation="MILILLAVMLTALTCIVAWYLATWALPVMVAVETFRLAHATEAGF
FT                   LLSVLAAGTAALLSVGLVLLVLFKAKNPILCLLARAVFVIPAMIAGYAVVHGVTHDAID
FT                   SAIALKLLCGTAGLITGIAALINLNGFGELAPQA"
     atgatcctga tcctgcttgc cgtcatgctc accgcgctca cctgcatcgt cgcctggtat        60
     ctcgccacct gggcgctgcc ggtgatggtc gcggtcgaga cgttccgtct cgctcatgcc       120
     accgaggccg ggttcctcct ctcggtcctt gcggcaggaa ccgccgcgct gctgtcggtg       180
     gggctggtgc ttctggtgct gttcaaggcg aagaacccga tcctctgcct gctggcgcgg       240
     gctgtcttcg tgattccggc gatgatcgcc ggatatgccg tcgtgcatgg cgttacccat       300
     gatgccatcg actccgccat cgcactgaag ctgctttgcg gcaccgccgg cctgatcacc       360
     ggcatcgcgg cgctgatcaa tctgaacggt tttggagaac tggcgccgca ggcctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page