(data stored in ACNUC7421 zone)

EMBL: CP000489.PE120

CP000489.PE120       Location/Qualifiers
FT   CDS_pept        110943..111620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0120"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   nha:Nham_0569 DNA methylase N-4/N-6"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68237"
FT                   /db_xref="GOA:A1AY93"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY93"
FT                   /protein_id="ABL68237.1"
FT                   /translation="MTAQENTPRNLVINADCVEAMQAFGTGSVDFILTDPPYVTRFRDR
FT                   QGRTVANDDNARWLRPAFAQMHRVLKDGGFCVSFYGWNKVDLFVEAWKAAGFRIVGHLV
FT                   FRKRYASSARFLRYEHEQAYLLAKGDPELPAQPVPDVLDFPYTGNRLHPTQKPVAALRR
FT                   LIGAFTQPGDLVLDPFSGSGSTLAAAHLLGRDWLGVELDVSHYQTIGRRMAALQERDRK
FT                   AAA"
     atgaccgcac aggaaaacac cccccgcaac ctcgtcatca atgccgattg cgtcgaggcg        60
     atgcaggcct tcggcaccgg ctcggtggat ttcatcctga ccgatccgcc ctatgtgacc       120
     cggttccgcg accggcaggg ccgtaccgtc gccaatgacg acaatgcccg ctggctgcgc       180
     ccggccttcg cccagatgca ccgggtcctg aaggacggcg gtttctgcgt cagtttctac       240
     ggctggaaca aggtggattt gttcgtggag gcctggaaag cggctggctt ccgcatcgtc       300
     gggcatctgg tgttccgcaa gcgttatgcc tcctcggcgc ggttcctgcg ctacgagcac       360
     gaacaggcct atctgctggc caagggcgat ccggaattac ctgcgcagcc cgtgcccgat       420
     gtgctggatt tcccctatac cggcaacagg ttgcacccga cgcagaagcc ggtggcggcg       480
     ctgcgccggc tgatcggggc gttcacccag cccggcgatc tggttctgga cccgttcagc       540
     ggcagcggtt ccacgctggc ggcggcgcat ctgctgggcc gcgactggct cggggtggag       600
     ctggacgtga gccattacca gaccatcggc aggcggatgg cggccctgca agagcgggac       660
     cggaaggcgg cggcatag                                                     678
//

If you have problems or comments...

PBIL Back to PBIL home page