(data stored in ACNUC7421 zone)

EMBL: CP000489.PE121

CP000489.PE121       Location/Qualifiers
FT   CDS_pept        111692..111982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68238"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY94"
FT                   /protein_id="ABL68238.1"
FT                   /translation="MRWIVTKDHHGGCIGLGEDADGVPARGKPGDGDALPSEFRLYTAR
FT                   GRLLFEGRCGDIDADWWHGMEPLLYAWTTFRCRRLTWRPAGTDEPWRPLRP"
     atgcgctgga ttgtcacgaa ggaccatcac ggtggctgca tcggactggg cgaggacgcc        60
     gacggcgttc ccgcacgcgg caagcccgga gacggcgatg ccctgccgtc ggagttccgg       120
     ctttacaccg cgcgcggcag gctcttgttc gagggccgtt gcggcgacat agacgccgat       180
     tggtggcacg gcatggagcc gctgctttac gcctggacca cgttccggtg ccgccggctg       240
     acctggcgcc cggctgggac ggatgaaccc tggcgcccgc tgcggccata g                291
//

If you have problems or comments...

PBIL Back to PBIL home page