(data stored in ACNUC7421 zone)

EMBL: CP000489.PE127

CP000489.PE127       Location/Qualifiers
FT   CDS_pept        complement(115281..115730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_3838 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68244"
FT                   /db_xref="InterPro:IPR018754"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA0"
FT                   /protein_id="ABL68244.1"
FT                   /translation="MRTSEGLHGIVADAGGDHRLWFPHGMARIRLAIVVPLDEDLMVRL
FT                   NSIQRFHRLLTGRPVRPIPSLQALSASERHRATLMLRAWDGAESGASRRDIAGVLFRTD
FT                   FSGLSAAEWKSASERRQLARILAEARSMVGGEYLTLLRGGQHRRR"
     ttgcggacaa gcgaggggtt gcacggcatc gtcgccgatg cgggtggcga tcaccggctc        60
     tggtttcccc acggcatggc ccggatccgg ctggcgatcg tcgtgccgct cgacgaggat       120
     ctgatggtcc ggctgaacag catccagcgg tttcatcggt tgctgaccgg caggcctgtc       180
     cgcccgatcc cttccctaca ggcgctgtcg gcatccgagc ggcaccgcgc gaccctgatg       240
     ctgcgtgcct gggacggggc cgaatccggc gcctcgcgcc gcgacatcgc cggcgtcctg       300
     ttccggacgg atttcagcgg actcagcgcc gccgaatgga aatctgcctc cgagcgccgg       360
     cagcttgccc gcatcctcgc cgaggcacgc tccatggtcg gcggcgaata cctgactttg       420
     ttgcggggcg gccagcaccg gcggcgctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page