(data stored in ACNUC7421 zone)

EMBL: CP000489.PE128

CP000489.PE128       Location/Qualifiers
FT   CDS_pept        complement(115825..116091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0128"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68245"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA1"
FT                   /protein_id="ABL68245.1"
FT                   /translation="MPSSTDWRSPGYDNRFRTLDRARMTFQFLRRNRRYRAEYSRIRQH
FT                   IGREAPVADATREEIARMARRWGLMFPGRSRTSGIGSPAALAS"
     atgccgtctt ccaccgattg gaggtctccg ggctatgaca accggttccg gacgctcgac        60
     cgtgcccgga tgacctttca gttcctgcgc cgcaaccgcc gctatcgcgc ggagtattcc       120
     cggatccgcc agcatatcgg gcgcgaggcg cctgttgccg atgccacgag agaggagatt       180
     gcccggatgg cccgccgctg gggcctgatg tttcccggtc gatcccgcac ttccggtatc       240
     ggaagcccgg ccgctctggc gtcctga                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page