(data stored in ACNUC7421 zone)

EMBL: CP000489.PE131

CP000489.PE131       Location/Qualifiers
FT   CDS_pept        117115..117384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nwi:Nwi_0845 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68248"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYA4"
FT                   /protein_id="ABL68248.1"
FT                   /translation="MQNEPDPDWPRFVRTEEAARLLDLSPRTLEKHRCGGTGPVYRKLG
FT                   GRVVYTIADLRAWIEGSARQSTSEMAKIARKPDRTLAEARRAGR"
     atgcagaacg aacccgatcc cgactggccg cgcttcgtgc gcaccgagga agccgcccgg        60
     cttctggacc tctcgcctcg cacgctggaa aagcaccgct gcggcggcac cggtccggtt       120
     taccgcaagc tcggcggtcg tgtcgtctac acgattgccg acctgcgcgc ctggatcgaa       180
     ggctcggcgc ggcaatctac ttcggaaatg gcaaagatcg cccgcaagcc cgaccggacg       240
     ctggccgaag cgaggagggc agggcggtga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page